80 predicted lipoproteins out of 7577 predicted ORFs for Streptomyces avermitilis MA-4680


Functional assignment
Protein sequence
Signal peptide features
Superfamily Assignment

PSA tool

>gi|29826632|ref|NP_821266.1| MTLPSRRAFTAAAMASLLVGCAGPGAGQATTAARPGRTPSSSRAAAKPAHALGRSVPVGL QIPAIGVDTPLLRLGLAADGSVQVPPVTAHDRAGWYRHSPTPGQRGPSVILGHVTVGAYG DGVFRHLARLRRGERIVARLENGTAAVFAVTAVRTVPKADFPADAVYGDVNRPELRLITC GGPRNGDGYLDNVIVFAALSSASP
n-region:MTLPSRR
h-region:AFTAAAMASL
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|29827185|ref|NP_821819.1| MLRHRVVVRHLTRATVTSCCAAALALTQTVQAHAASRTVNFNYQHIWKTPEFETGIRGRI HFTVKKCDHPNGDMTVLLRRTDGFNYVVGSRNIKCRAGHTANWDDDPAGTYEFELGKLDD YKFFKGTATYSFNAAR
n-region:MLRHR
h-region:VVVRHLTRAT
c-region:VTSC
Superfamily Assignment

PSA tool

>gi|29827373|ref|NP_822007.1| MMRVGIIGAGNIGHMHAEAVAACENTLLTGVFDLDRERAQSLARASGTVAFASPDELYKA SDGVVVASPNRTHADYAREAVAYGRSVLCEKPMAVSLLQAADMRALAAVAPGVCAVGFNY RYLNVIREARNRIGEGMLGRVVHVDVAFKRASALTRQHFTWRDSAAEGHTSGALGDLGVH LIDMLHHLFRSPVDLASCQVALRTKVAAKGGHAVEVDDHAFVSGRIEGGPSFTLTASKAS QPEETGFTLAAMGSRGDLSHDSQDGPVLHLRTGIDWEQVKLLGPSRLDDPRGEVTGWGDS FLDQLHDWAGAVTASQRSGTLADFEDGYQAQQVLQELLRIGGRM
n-region:MMR
h-region:VGIIGAGNIGHMHAEA
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|29827867|ref|NP_822501.1| MPNTKHCRLVATALAVALGATTLAACGSSDDDSDARSGPASLTYWTWTPGMDKVVDLWNK GPGKKQQITVTVKKQASGDTLVTKILTAHKAKKAPDLVQAEYQALPTLVSNDALADISKN AGDAKGKFAEGVWQQTTLGSDAVYAIPQDIGPMMFYYREDLFKKYGLTVPTTWEQFAKTA RALKHKAPDKDLTTFSSNDSGLFAGLAQQAGAKWWTTSGQKWKVGINDAASQKVADFWGG LVKEGAIDNQPMYTPAWNKALNTGKQIAWVSAVWAPGTLTSGAPDTKGKWKMAPLPQWGD SDSVTGSWGGSSTAVTTDSKHQAAAAKFATWLNTDPKALTALAKESGIYPAATTAQTSDA FQEPPAFFSNQPDFYPQAAKIAKTTAPSAWGPNVNVAYTTFKDAFAAAAKNKSDFGAALA KMQDDTVADLKKQGFEVSE
n-region:MPNTKHCR
h-region:LVATALAVALGATT
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29827995|ref|NP_822629.1| MKNTGQLSRRGLLAVAGFAGLAALTGCGSGDGEADTKDLSKKRAGAMKNYGAGDQFKATK ALTFTILHNDMPTYPMKRDWLFWKEVTERTGVTLKPTSVPASDYDKKRSLLIGAGDAPLL IPKTYPGQETAFVSSGAILPVSEYVRLMPNFRAKVEKWGLEGDLDSIRQADGNYYVLPGL HEKVKSGYSLSFRTDVLKKHGLDLPTTWDQVYDVLKALKAAYPDVYPFSDRWGQPTPGGA LLNYLGPAFGTKAGWSYANTAWDTKARKYVFTGATDEYRQMLEYLRKLVAEKLMDPESFT QSDDDAVRKLLSGKSFVISANPQELVQNYRYNLGKQVKGATIEMIPVPIGPTGEVIVGSR LENGLMVAGRAAEGDSFVAMMQFVDWLWYSDGGQEFAKYGVEGVTYTSSGAGRYKVADGI SYMGSDPSAPKDLQKDYGFTNGEFAYGGSWALVSSSFSPDEKAFQDAMAGRKLLPVDPAH PLKADEQEQATLWDTPLKDHVTQNTLKFALGKRPMSEWDAYLAELKAKNMQRYIDLHNTA YERFKKEHG
n-region:MKNTGQLSRR
h-region:GLLAVAGFAGLAA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29828102|ref|NP_822736.1| MRRRLAPALLLPFPLLLAACGGNSAAGTSTGGRTDGKGSLTLNVGDQKGGSEAVLRAAGE LKNLNYKIKWSTFTSGPPLLEAINAKAVDIGGVGNTPPVFAAGAGSKISVVAAWHGTSKG EAVLVPKNSSLRKPEELKGKSVAVAQGSSAHYQLVASLEKAGLKLSDVKVKYLQPADALA AFTSGKVDAWAVWDPYTSQVLQAKQGRALVDGDGVVNGLSFQVAAPSALADKKKSAAVKD YLERLRRAQDWVYEHPAAWAKVWAKDTGLPYEVALASVKRTNASRVPVAVDKPLIASEQQ IADTFTGLKLIPKKVDFADFVDTRFNGGLPASTSTPRVYKDS
n-region:MRRR
h-region:LAPALLLPFPLL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29828240|ref|NP_822874.1| MARMRRGVMTAALLAATVTGSLVTGCTTHGRAVDDGRNRQQGHPESQVSGSPSATAGPVL AVKIDNAGAARPQTGLDTADVVYAEQVEGGLSRLMAVFATNLPKTVGPVRSARESDLELL GQFHDPTLAFSGAQHKLLPLIDKAPLRAVSPEQDSNAYFRGGDKAAPHNLFLRPKRLLNS APGADALTTGFHFGAAPPGGTPEKARTVRFPAARFTFTWSEQRQRWLVSMDGTQAVTTDG ATVAPATVVVQHVKVRQSRFHDFLGSNTPYTETVGTGKAEVLRDGRVFDVDWQRKSATDG TEFTTADGSPMNFAKGQVWVVFAKA
n-region:MARMRR
h-region:GVMTAALLAATVTGSL
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|29828269|ref|NP_822903.1| MRSSGFRRACVALVACSFVLTACGSSGDAADGKTRITVNCMPPKSAKVDRKFFEDDIAAF EKKNPDIDVVAHDAFPCQDPKTFDAKLAGGQMEDVFYTYFTDATHVVDVNQAADITSYVK DLKSYDTVQQQLRDIYTVDGKVYGVPRTGYSMGLIYNRGLFEKAGLDPDKPPATWDEVRA AAKRIAALGGGTVGYADYSAQNQGGWHFTAELYSQGGDVVSADGKKATVDTPEGKAVLQN LHDMRWTDNSMGSKQLLVINDVQQLMGSGKLGMYLSAPDNIPILVKEKGGTYTDLALAPM PGGKGTLIGGDGYMFNKKATPAQIKAGLKWLDFMFLTPGKGFLGDYARAKKNDAPVGLPE PRLFSGAADARDQQVKKANANVPVENYQSFLDGNQSLRMKIEPPQAQQIYSVLDSAVSAV LTKKDADIDKLLKDASGKIDSILARG
n-region:MRSSGFRR
h-region:ACVALVACSFV
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29828525|ref|NP_823159.1| MARTRTWAIIALAGALSVSLAGCSSTGGKRAEDARKAASAQGKAAVNTPRWTFAMITHSG DGDTFWDIVQSGAEQAAVKDNINFLYSHNAEAQQQAQLVDAAVDKKVDGIIVTLAKPAAM KAAVARAEKAGIPVVTVNSGSEESKAFGALTHIGQDETVAGEAVGEELNKRGRKKALCIL HEQGNVGHEQRCAGVKKTFKGTVQNLYVQGTSMPDVQSSIGAKLQADSSIDSLVTLGAPY ADTAVKARNDAGSKAEIDTFDLNAKVAAELKDGTLGFAVDQQPYLQGYEAVDLLWLYKYN SDVLGGGKPVLTGPQIITKDQAAKLEQYTKRGTR
n-region:MARTR
h-region:TWAIIALAGALSVS
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29828602|ref|NP_823236.1| MKRPGTRFRAAAVCAAVVSLALPLAGCSSLETTAPSAARAHAAGAAARLGTVDCRQTKCI ALTFDAGPSENSARLLDILKEKKVPATFFLLGKRHIEKYPELVKRMADEDHEVASHTWDH KILTRLKPAEIRAELERPNKDIERLTGRQPTLMRPPQGRTNATVHKICRELGISEVLWSV TAKDYTTDDPKLIQKRVLAQSSRDGIILLHDIYPGTVPAVPGIIDALKERGYVFVTVPQL LAPGKAEPGTVYRP
n-region:MKRPGTRFR
h-region:AAAVCAAVVSLALP
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29828659|ref|NP_823293.1| MTRAARVPKALAVLPALLLLPVLLSACGTEKAGAGGSGADRAEVSRARLDARAAALGVAP ELVYVTEAPGFTLAQQSVGVYGGDGFSSVYVSRKTGAQIQLSVDRGTMTAANCPKQPLGE ASGERITCARDGDTWYRTAGGRQEYAVPEKGHVVRVSADANAVGRAVLRRAAGAAHRPDD TELAAVLPTPDGTATAPVERGDLPPVGDGAPNNDVGTSG
n-region:MTRAARVPK
h-region:ALAVLPALLLLPVL
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29828685|ref|NP_823319.1| MRRRWITALVALGLLLAGCSSDHDGSGGRITLRFQSLAWQEESVAANKELVEEWNATHPA VQVAYVQGSWDSVHDQLLTSFEGGEAPDVIHDASDDLADFAYGGSLADLRELLPARLMSD IPQRSWRTATFGDGIYGVPFLQEPRVLIANATWLKESGVRIPTPERPWTWDEFRRIAGQL SGKGKYGVAWPLKEPVSATLNLSLSTGGQMFHRGADGKVTVRFDAADALVPRTVHDEVNT DGSASGSTLGMGGSDTLPGFFGGKYAMVPLGFSYRQQIAQQAPKGFEWQVLPAPAGADGL AQGVSPQTLSVAADSPHKKEAAEFIDFLLRPKNMVRLALGDWMLPTGTEALKDPALHTAM DDWATGTALAAHLRSAPAQSVRGYPEWKDKVATPAFQEYYSGAIGLAELRKRLVEDGNLV LARYQR
n-region:MRRR
h-region:WITALVALGLL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29828756|ref|NP_823390.1| MIILVRRVAVAGALGALGAALAACGTPGASGTPHAAARPAHSAPTTAASSKPPTLTPGPS GLTPVFKNGPRTQGKTVALTFDADMTADQGARAAAGEHFDNPQLIGALRELKVPATVFMT GRWADEYPQEARAIGRDPLFEVANHSYSHYAFTSDCYGLPTVSEDRMRSDVERAFAAFEK AGVPHVMPYFRFPGGCYDQRALRTLIPVGVTAVQWDVVSGDAFATDADAVAQQVLEGVRP GSVVVMHCTRSAAPTTERAVRTIVPELRKKGFRFVKVSELIQAASGGRR
n-region:MIILVRR
h-region:VAVAGALGALGAA
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29828789|ref|NP_823423.1| MNTRMRRAAVAVAAGAMAVSLAACGSAKESKGDSDTSSSKKGDAITVGLLLPENQTARYE KFDYPIIKKQVADLTNGKGKVVYANAKQDATTQSQQVDTMVTNKVDVLIVDAVDAKAIAN SVKKAKDAGIPVVAYDRLAEGPIDAYTSFDNEEVGHAQGKALLKALGSKAKPSAKIVMMN GAITDPNAAFFKKGALAELKGKVDIAKSYDTKEWKPENANANMEGAISALGKKNIVGVYS ANDGMAGGIIQALKSAGISVPVTGQDAELAGVQRIVTGDQYMSVYKSYPQEAAVVAKMAV ALGKGEKLDSIATSKVDSPTTKQVPSVIVPVISLTKDNIKDTVIKEGFYTVADICTAKYK KACDSIGLE
n-region:MNTRMRR
h-region:AAVAVAAGAMAVS
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29828974|ref|NP_823608.1| MRMTARYTALAAAGLLALSSLTACANDAASTASSGSGSKGDGKGVKVKIMVGGLDKVIYL PAMLTQRLGYFDAEGLDVELLSEPAGVQAETALVSGQVQGAVGFYDHTLDLQTKGKDVES VVQFSHAPGEVEIVSNRHADDITSPKDFKGKKLGITGLGSSTDFLTKYLAVKNGVSVSEF SPVAVGAGPTFISALQKGSIDGGMTTDPTVANILAKNLGKVLIDMRTPRGSKEALGGPYP SSSLYMQTEWVNSHKDTVQKLANAFVKTLKWMSTHTASQIAEKMPADYSQGNKTLYAGAI KTTLPMFTDDGVMPKDGPETVERVLKAFNPNIKNAKIDLSKTYTTEFVEKVTG
n-region:MRMTAR
h-region:YTALAAAGLLALSS
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29829162|ref|NP_823796.1| MSTTKKFTAAALAAGLGLVTLSACGSSGSGGGDADSKTVTLVSHDSWAASKSVLEDFEKQ SGYTVKVLKDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQPYEAKGSGLI RPEYQVDRAKHRVTPIDSGDICVNYDKKYFADHKLDPPASFGDLVEPRYKNLLVTENAAT SSPGLGFLLGTAAEYGDKGWPDYWKKLKANGVKVVDGWEQAYNQEFSGSAGGKKAKGDRP LVVSYASSPPAEVIYASPKPKTAPTGVASGTCFRQVEYAGLLSNAKNTKGGKALLDFLVT KEFQEDMPLNMFVYPVVKGAQVPAEFSEFGPAAKSPETLAPAEIADNRDQWVKSWTSLVL K
n-region:MSTTKK
h-region:FTAAALAAGLGLVT
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29829310|ref|NP_823944.1| MEGNPTIMRRSALAAIAAIGSASLLVAGCSKADDNKDDNNSKSAGANAATKDVVNASTKK GGTVTYEYSDVPDSFDPGNTYYAYMYNLSRLYARPLMTFKPAPGEKGNELVPDLAASAGV PSDGGKTWTYKLRSGLKYQDGTAITSKDVKYAVERSNFARDVLSLGPNYFQQFLVGGDKY KGPYKDKSAKGLKSIETPDDTTIVFKLNRAFQEFDYLVAAPQTAPVPQSKDKGIDYVKSI VSSGSYKFQSYDDGKQAVLVRNENWDPKTDPLRKQYPEKIVVNLKVNAETIDKDVQAGDA IDLGGTGVQAATQAQVVNSAEKKANTDNTYGGRLVYMAINTKVKPFDKLECRKAVQYAID KVSVQTAEGGPIRGDIASTVLPPDIPGYEKSDVYATSGNKGDAAKAKEQLKACGKSSIKT NISARSDRPQEIDAATAIINSLKKVGIDASLKQYPSGKYFTDYAGVPKFTEKQNLGLIMM QWGADWPSGYGFLQQVLNGSAIGSSGNVNLSQFDNKDVNSLLGKAIGTEDKTARDALYTE IDKKTMDEAVLVPLTYFKVLLYRPTTYTNLVSTAAFSGQYDYLNIGSTKK
n-region:MEGNPTIMRR
h-region:SALAAIAAIGSASLL
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|29829590|ref|NP_824224.1| MRRTPAAALVAATAATALLVTGCGSSDDDKPQAQKSAAPAGSQQINAHPLSDIQQGGTLK FAISQYIADFNRYTANGNQGDAATINELVEPSLFTADARGAVRPNENFLLSASVTSTSPQ VVTYKLNPKAKWSDGAPLSWRDFRALWKATNGTNKEYEAANTSGYDQISAVGQGTDAHQV KVTFSSPYADWKRLFDPLLPAAGIDTPAKFNKGWTEKIPVTGAAFKISAYDRTAQTITAV PDPQWWGTKPKLDSIVFRALDFSAWTDAYLNKEIDYASAILPEDYKRLAKAAGTDIRTGA RWDEVHITLNGARGPLKDVRVRQAVQHAIDRKAIATAFGKDLPVELKTYGSHFFMPNQAG YQDNSGTYGTYDVEAAGELLDAAGWKTKGDTRVKDGKQLALTYALSAGSTSAQEDQAELV QAQLAAVGIKVSIKKVPTNDYFSKYVTIGNFDLVSFRWVDQIFRSEAYPIYRQTAGKNLY ENYGSVGSPEIDTLLKKAGETTDATEQAKIYNEADTKIWALGHSIPLYQRPQVLAVRSNL ANYGAGGLADDDFTKVGWLKKK
n-region:MRR
h-region:TPAAALVAATAATALL
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|29829622|ref|NP_824256.1| MPNPPRLRAAVLTATAVLLSSSVTGCSHDNDTKDEDLSGQKLSWKDCPAPSESEGGGNAP SPLPDGDEWQCATMKAPLDWAKPRGDTIDIALIRAKTSGEQSKRIGSLIFNFGGPGGSGV ASLPAFGKDYEKLRTRYDLVSFDPRGVGRSAGVKCEDDAQLDEYFQQDATPDDTAEQKNL LANTKTFNSACEKHSSRILPHVRTTDAARDMNLMRQVLGDTKLHYFGISYGTELGGVYAH LFPKSVGRAVFDAVVDPTQNPEQGSLGQAEGFQLALDNFAEDCTSKTTDCPIGDTAQDVK DRIATLLKDLDSKPIPGVFPRELTQTAATSGIAQALYSKDFWEYLTEGLEQAYDGDGKVL MLLSDSMNGRNANGQYSNLVAANVSINCADDKPRYTTADVQAKLPQFKAASPLFGDYLAW GLLSCTDWSVAGAADHPDVSAPGAAPILVVGNTGDPATPYEGAKKMVDALGKGVGVEMTY KGQGHGAYDSKNKCVQSAVDGYLLDGKVPAANTVCS
n-region:MPNPPRLR
h-region:AAVLTATAVLLSSS
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|29829623|ref|NP_824257.1| MARIARWTALAAAALLVAGCGGGSSDDGKETGEADRSADSSTSSSPSGTPSQLPASLTSQ KLGWGRCKATSDSPAPGGDWQCATLKVPLDYAKPDGETIGLALIRSKATGGRRIGSLLFN FGGPGASGVSYLPSYATTVSKLHERYDLVSWDPRGVAASEGVRCRSDRAIQAAESVDSTP DDSTEQQAYLKDSADFGKGCEKAAGKLMSHVSTTDTARDMDLMRQVLGDRKMHYFGISYG TELGGVYAHLFPKNVGRLALDAVVDPSADTVGHAKNQTRGFQRALDDYLKATGQDPKQGS QKIVDLLKRIDAKPLPTSSGRKLTQTLAVTGIVLPLYSEQSWPVLTSALKAAEGGDGSEL LLQADSYNDRDASGHYGTTTHSQRVISCLDDRQRPTPEETKKRLPEFEKISPVFGDYMGW DTAGWCHNWPVSGQYDNPEVSAPGAEPVLVIGNTGDPATPYEGARKMADELGKDVGVELT WKGEGHGAYGSGSDCVDSTVDSYLLNGTVPKDGKVCS
n-region:MARIAR
h-region:WTALAAAALL
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|29829693|ref|NP_824327.1| MSFSRRNFLIATGVVAASSSVLSACSSGDSSGGSGGGKQDAAKAKTTTVKIGTAADSKGP APEVPGAKKGGTAYLLNDDDFSHLDPQRIYYAWNSLAAIVLSRTLTGYKVGDDGTMTLVG DLATDTGKMSDGGKTWSFTLKDGVKWENGADVTVDDVRHGIERAFASYITEGAFYVQAWL TGSQNYRKSYSGPYKGKHLKSIETSGKTITFHLSEARPDFNYVVAMHSYAPTPVKKDTKE DYDKKPVSNGPYRVKSHVTDKSMVLVRNEHWDADTDPIRNAYPDQFDFTFGIEQLTAVDR LIADAGKDKYAVSWRTIPQERIQKATTEAKDRVFEELGSGVSVYWINTTRVKDKAVREAL IKAWPTAQIRQLMGGVHRGDYATGIMSPLVAGYESQDVWGKLKTPAGDPKAAKKILDKAG KTKQKIVYAYQQDDVQPKIAVVIENALKAAGFDVVTKAIDSTTWYDQIGKLDNPFDVYWG GWSSDWPTGYSVFQPLFDSANVVDQGQNYSHLKDPAVDAAIKAATLETDQTKANKMWAAL DKQVTEIGAFIPDVYMKRIYLHGSKLGNVKMDPNFDGCMLYKMYVKS
n-region:MSFSRR
h-region:NFLIATGVVAASSSV
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29829717|ref|NP_824351.1| MMSRGGRHAYAAISVLAAGALVLTGCSKGGSDSGNNDKKDKENAQRQQASIKFGDAKDST GPAAAVPGAKTGGTMEVLQRDSYAHLDPAQIYVSDEGSVATLLHRGLTGYKATSNDGSKH EVVGDLATDSGTTTDGGKTWKYTLKDGIKFQDGTAITSKDVRHSVERLFAPFINQGPPYL QQWLADTPGADYRKLLKDGPYKGKHLPDSVLETPDAKTVVFHFKTAHPDLPYALAMAGYA VVSQKGDTKEKYDRAPVAAGPYKIQSFKSGKSMVLVKNTSWDPKTDPIRHQYVDRFNFTF NQQYETSTKTLLADSGADQAGVSFNNQVDAGNLSKVLSDPKMKSRTVGGFQPYVGQMNIN MSHPALKDKKIREAIAYALPITPFVRAYGGTDAMQVAGGLISPTVSGYDASFDPFGKIKK PAGDPVKAKALLKEAGKVGMKLTFGYINTPEGQQYSTAMAAGLKKAGFNVQRQEIPAETY YDQVSKLDNNYDIFHTAWGADWPSASTVIPPVFDGRAIADGAQNYSQVNDPHVNSEIDRV NKITDPVKSAAGWEKIDQYLVKEVVNVVPTAYYKQIQIAGSKVGGLAYDDVIGGIDPRRL FVK
n-region:MMSRGGR
h-region:HAYAAISVLAAGALV
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29829912|ref|NP_824546.1| MRRVSRIAVAGVATATLAVSVAACGNSSSESSSSSSSGGTAKGVALAYDVGGKGDQSFND AATTGMEKAGKEFKTATTAVEPQDGESDADKVQRLEQLAKSGYNPVIGVGFAYAPAVKEA AAKYPKTTFGIIDDEQVKADNVADLVFHEEEASYLAGVTAAKTTKSNVVGFIGGVDVPLI HKFEAGFAQGVKDTKKGVTVKSQYLTETAAEGGFSSPDKGEAAAEGQIGAKADVVYAAAG LSGQGVIKAAAAHKVSAIGVDSDQYKQDALAKYKNSILTSAMKDVAGAVYNLAKSVHDGK PETGVVRASLSTGGVGLADSNPTFKNNAALQAALKKAEAGIKDGSIKVKTN
n-region:MRRVSR
h-region:IAVAGVATATLAVS
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|29829965|ref|NP_824599.1| MANSRRQLRSGTVVLGGMGLLAAALTACSSDEPDKRCVDRDSYNLGKGGYKVVADKNCKT GSSGSGKVSSGYTWYYGGDRSKSRIDSGSFTKPSKGSGGSSGGGGVDRGGFGSGKGGSGG
n-region:MANSRRQLR
h-region:SGTVVLGGMGLLAAA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29830051|ref|NP_824685.1| MNRRTLLGGLFAAASVPALAACSSGITSLDSQGSGGSGGGSSKGGVIIGTANFTENQVLG HLYAAALEAAGVRTTVRPNLGTREILIPALRGGDIDLLPEYQGALLHYLAPKATATEEGA MQNALTVALPSGLQVLPYGMAEDSDAFVVTRATAKKYGLSSLADLKKQNGELVIGAAAEV KKRQVGVVGLKDVYGVEFKEFKSLDSSGPLVKGALRKGDVDVANLFTTDTDIQANDWVVL SDPRNLVPGQHVVPLIADRKADSTVRRALAELGNVLTTAQLTELNRQVDKDKKDPEDVAN AYAEQHGLVKKK
n-region:MNRR
h-region:TLLGGLFAAASVPA
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29830081|ref|NP_824715.1| MHRRRRTALVLSAAIVAAAPLLTACGGEAHPGAAAVVGGQRITVAQLESRVNEVRTAQRA ATTDDAQYEQTIAKTGSLTRDTLHSLVLDRVLDRAAKDAGVSVTRKDAQQMRTALEQQAG GTKALESAWLQQYGVAPGRLDDSLRTEIEAQKLATTLGADMNTVNGKAAFWKAMSEASKK LHVTLNPRYGTWDVQKSSRVDAKTPWLREVTATTTQQTA
n-region:MHRRRR
h-region:TALVLSAAIVAAAPL
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29830086|ref|NP_824720.1| MRRTALAALCLAAAATAGLTGCLPGQDKADSKPKGPFAGLTGGEIADRAVKATNGASSLR MKGDVPDDESGGTIQLDMALNKKGECAGTMSMDGQGKADLIKTDDTVYMKYDEAFLRAQS KGEPKGDTDAVVAMMAGKWTKMSAKGQDAKDIASFCDLGTVLAGAEDVNSDATRGKTTTV EGTPAIVLHEKDGKDRYTLYVATEGKPYLLKVVSTSAKDAGTIAFSDYQKPVPAEAPKGK VLDLDALSD
n-region:MRR
h-region:TALAALCLAAAATAG
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29830228|ref|NP_824862.1| MATPNIAARRAVVACAALVVGALSLTACGGSADANVGKGDGKSGSGSGNTSTAKITISAK DGSTGASINATGVKVSDGKLTDVKMTVAGAGTAVSGAISADGKSWKPAKQLDRGVKYQIS ATAKDASNRTAAANSIFTTVNSANSFIGTYTPDNGSTVGVGMPVSFNFDKVIGDKKAVQS HITVSSSSGQRVVGHWFGAQRLDFRPEAYWKAGSKVTMKIDLDGVEGANGVFGVQKKTVT FTVGRSQVSTVDVSTQTMTVVRDGKTVKSVPISAGSPQHTTYNGQMVISERFAQTRMNGS TVGYGGEYDIPDVPHAMRLTSSGTFIHGNYWYNRGNPPFGRQGTSHGCVGLADVQGAQGD TVAKWFYDNSLVGDVVTVKNSPDKTVAPDNGLNGWNMSWSAWTAGSAV
n-region:MATPNIAARR
h-region:AVVACAALVVGALS
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29830292|ref|NP_824926.1| MTIKRGTPLIAALAATLLLSACSSPDTDDRRVTDGRTSQWDKNAGAPEASAFMNVTAPKA ATEVKGAVQINPQEDIHLLSFVTSEKNAEGIARDLRSEEPLKANKADFAPDGELFKHLGL AEPQTLKGARSAGVCPPCVKDDRRKKVQWIDIYVQALKDDQARVYLKAF
n-region:MTIKR
h-region:GTPLIAALAATLL
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29830319|ref|NP_824953.1| MRSYSDLFRTREFTPLFVSSCFRTAAATVSGLALGTLVYRATDSPLLSALSMFGPSLAQV VGATTLLSAADRLPPRATVAGIALAFALGTAVMAAPGLPVWTIFVLLLLLGLVQSLGGGV LWGLLNEILAKEGYLLGRSVFNMMSGVAQITGYATGGVLVALLSPRVTLLAAAALYLASA LTARLGLTGRAPRASGRPSVVQTWRTNARLFSSPERRTLYLLLWIPNGLIVGCESLFVSY APSRAGALFAFAAFGMFVGDVTTGRFLAPRVRARLGIPFLLLLAAPYLLFALRPGVALAT ACVAVASIGFGSSLIQQERLVSLIPDELSGHGLGLHTSGMLTMQGVSAALAGGVAQLTSP GPAMTIMAVASITVTLTLAPSLLRRGAASRDRRHPEVSAPKERRSGVNSS
n-region:MRSYSDLFR
h-region:TREFTPLF
c-region:VSSC
Superfamily Assignment

PSA tool

>gi|29830447|ref|NP_825081.1| MRRRRAVAAAGAVSAGLLVLSACDKPTPLSTITVGQSSVSSEASCYNDGKPLATADLAKC LKDTDIKSIKVDPDETVRFGVDPDVAKKGWTILMNGQALTEASKKTYRTIPGSVFFNAQY GASGNSTLVSIQEGEKAPFTGLWSFKLKKDAG
n-region:MRRRR
h-region:AVAAAGAVSAGLLV
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29830482|ref|NP_825116.1| MQRRTTGLIAVLSALGMTATLAGCGSSEDSGDVTLKLVAADYGDSSANSSQKYWDTLVKE YEAKHPGIKVEVSVYSWNDVDRKVKEMVAAGKAPDMAQIGAYADYAAAGKLYTADDVLSI PVQADFVSELSTAGQLNRVQYGMPFAASTRLLFYNKKLFAQAGITGAPKTWDELAADAKA LKAAGVKTPYALPLGPEEAQAETMQWLLSGGDGYLSSVGTYNLDSAQNVATFAWLKDELV GKGLTGPTAPAKLNRAAAFAAFTRGEVGMLSGHPTLMKMAAKKGVKFGMVPMPGVDSGPK ATMGVADWMTAFRKNGHKQQIGDFLDFVYNEKNVLAFSHEYDLLPVTNSASEAMAADKDD ADMGPFLEELPTSQLYPVGKTSWASVSADIKKQIGKAVSPSGNPAAILGQLQRTADAADT SDIAE
n-region:MQRR
h-region:TTGLIAVLSALGMTAT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29830495|ref|NP_825129.1| MPRSAAAVPSALALSLVLALTACDGGVQGTPGGSGLRDPYFAKMGNGGYDVTHYDLTLAY DPGRRHLTGTAVITARAKQDLTAFALDLDGLDVGGVTVEGRPARWNRTGQELTVRPHDDL DKGETFRTTVRYSGTPVTITDPDGSKEGWLKTADGALGLGEPTGSMAWFPGNHHPSDKAS YDIEVTVPKGLRAVSNGELTRETTSGDRTTFAWHTPEPMASYVATVAIGHYDVRRSTTKS GLPVYVAVDPTQAKASAKVLAKLPEIMEWEENNFGPYPFSSTGAIVDRENDAGYALETQN RPVFPGAPDTGTLVHELAHQWYGDSVTPKSWRDMWLNEGFATYAEWLWQEDHGGETAQET FDALYRGDGGGDGAADKARWAFPPGKPPGAAHISDRPVYERGAMVIHKIRETVGDDTFYD IIQGWAATHRHGNADTADFTTYVEKKAPGKDFSAIWDEWLYGEGKPAKP
n-region:MPR
h-region:SAAAVPSALALSLVLA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29830514|ref|NP_825148.1| MSSSLRRGALAAAAIAFSIASLAACGAGNNAQTLEVKPDNAATSVGDIMVQNALVITQPD PKATGPAVISATLFNNGRTAQTLDSISVEGDGTAELSPAKGKGKVTVPAGGSVVLGGKGN ASAVLASPGADVKTGNAQKVTFSFSKTGDVSLRAFVVPAESYFSKWGPSQIPAAPGATAS ATATATTSPSGSASGTPTDKASSSTATATATATASNSAGH
n-region:MSSSLRR
h-region:GALAAAAIAFSIAS
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29830615|ref|NP_825249.1| MNRRALTLGALAVSGALALTACGSDDTGKSNTDATTSSNSAIKCDNAKGQLQASGSSAQK NAIDAWVKAYTASCKGVQINYNPTGSGAGVTAFTQGQTAFAGSDSPLKPEEVTASKKACG GSQAIDLPMVGGPIAIGFHLSGVDSLTLDAATLAKIFDGKITKWDDEAIAKLNPSAKLPS TKIQAFHRSDESGTTDNFTKYLKAVAPSDWKYSGGKAWQAKGGQSAQGSSGLAQQVKQTE GAISYFELSYAADGISTVDLKTGAATPVKASVENATKAISTAKVAGTGKDLSLSLNYKPT EEGAYPLTLVTYEIVCEKGNKADTLPATKSFLTYIASEDGQKLLTDAKYAPIPDEIISKV RTTISSLS
n-region:MNRR
h-region:ALTLGALAVSGALA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29830782|ref|NP_825416.1| MRKKTYAAAALFAAAALSLSACGTGDDSNKPIADVSAETGSDKAAVVLDSPFEKPDLVLT DTHGKKYDLRAETKGRPTLIYFGYTNCPDVCPLTMNNLAVAKKQLPKATQDKLRIVFVTT DPKRDTPAELGKWLKGIDPDVVGLTGDFDTIQAGARTLGISIEAPHKDKNGKIVSTHGTQ VIAFSPKTDGGYVLYDDQTTVDDYTKDLPKLAKGENP
n-region:MRKK
h-region:TYAAAALFAAAALS
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29830783|ref|NP_825417.1| MRRPAGAAVGLAVALALAGCGSDDEAASASSAKPELKVTGAYMPAPSMGTMAAGFFTVAN SGGADTLTSVSSDLSADVTLHSTKGGAMEEETSFPVPAKGQLDFASGGNHLMFEKLTHKP EQGEKVSVKLHFAKSGTVAVEMPVKAATYNPKTGH
n-region:MRR
h-region:PAGAAVGLAVALA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29831039|ref|NP_825673.1| MRLQRAVVGSAALVVLSLLAGCGSDDPMDDLGLPSAGDMASIAYYLNKHTSCLDLTAEAD ATDYLVEEAGDPAWGIKERASCEGEDGGNITLFTLKDMKKFQTAVKKDDDRPAFAVGRDF AVVPENDTTVQQLSSSEMMFLTCDPDFTVPSGYKKVSGLVDGCVLSDYFPTD
n-region:MRLQR
h-region:AVVGSAALVVLSL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29831040|ref|NP_825674.1| MRPTPSLVTAAVSLVLLSTLSACGPDSGDDAKALPSAKTLKEAQEFIAKAGLPCTSMTTD EGAHGTPAEGFLGTTDDYDSPQEKREAAAWKIGEAGFCGDTRAKAGGWIVYLPKDMKAFQ QNYRKTALAADKEYGDKYSDLRTGRFLIGADFVVNPTNSLRTSGLLETGLLIENCDPDLK VPTGYRKQDASAAGCVLTDYVPS
n-region:MR
h-region:PTPSLVTAAVSLVLLST
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29831144|ref|NP_825778.1| MAATHKIAAGVALAAACATALAGCASDTTGSKEGAYGPEKAGAPAPKSAVRLIGDGSTSY TGAQPHLPRPERLKPGQKPPQFVVFSWDGAGEDSQKLFSHFRKVAKANNASMTYFLSGVY LLPEEKRDLYKPPEHSPGRSDIGFNDQHGIKETAKQLRLAWLEGNEIGTHFNGHFCGKGG GVGEWSVEEWKDEIAQAKSFVKSWKTNADLAKAAPLPFDYDKELIGARTPCLEGQENFVK AARDLGFRYDTSGVNNQVWPKKREGLWDLSMQLVPFPGHSYEQLTMDYNFMVNQSGTQTQ GDPAKRQLWGDQMRDGLLEGFRRAYDGNRAPLIIGNHFESWNGGTYMRAVQEVIESVCTM DEVRCVSFHQLVDWLDAQDPQVLQKLRKLTVGEAPRQGWAAFLPGRPPAPAPKGVPGAPA FKP
n-region:MAATHK
h-region:IAAGVALAAACATA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29831160|ref|NP_825794.1| MEGTNPVNKKLAAALSGGAVLVLALSGCSSSDDGGSDKLNSWAKQVCDAVQPQAKKIEAA NTAIQKETSDNSAPADVQKTDSQAFQDISDAYKAMANAVDKAGAPDVENGKTKQANAVKE LDDLSSAYADLKKQTDELDTKNQAKFADGLKGVATQLEKLSKSGSDALNNLEEGDVGKAM AQQASCKSASAPASATKG
n-region:MEGTNPVNKK
h-region:LAAALSGGAVLVLA
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|29831182|ref|NP_825816.1| MRAIPIAVTALAAALALTACDSGGSGSGSSDQSSKAASCRFGIEVEPGNAATTAGDTGNV PVTVTNLDSAPCTLKGFPGIELNSGDASWTAGRQPGAKAAKVTLQPDTAATFTITYVRGK SGAKDSAAVKTVKITIPGGGDAKSFPWSYGAVALKTGDDPNASVSPFQVAGD
n-region:MR
h-region:AIPIAVTALAAALA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29831295|ref|NP_825929.1| MQRKAYVPGAAVLLAALLAACTGGSGSDSPPDDPKPGDTGPSATAAQPGKYRTLSDACSA LSQGTLDSLLPGIEQLTDQEQRDRAYQGEATPTYDNDRRSGCRWKAESTDATDHLLVDFE RVVSYDNAVSDDTRAQKVFAAKQTDANLPEPSASGSGPEGSEGSEGSESSTSTSPSGSAS PTPSGDSSRSAGSGGASSSGSATATAGATATGTPADLQPRTLDDLGDAAFLNDVLSTARQ RTVTVVFRTSNVVVSIGYDEQSAHPGTVPDSEEMQDRVRKLAQQLADSFAG
n-region:MQRK
h-region:AYVPGAAVLLAAL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29831340|ref|NP_825974.1| MRDISRRGLIGLGAGAAAAMGLAACGTQEQDGGSHSGGSGKGKPGKPEHTARPLGDGSTS NTGKQPRQPGKPVPLEPGQTPPQFVIFSWDGAGEVGNGLFPRFLELAKEHDAHMTFFLSG IYLLPESKKRLYRPPNNAPGASDIGYLTDDHIKATLKNVRQAWLDGHEIGTHFNGHFCSG YGTVANWTPKQWRSEIDQAKSFVKEWRTNTGWTDLAPLPFDYDKELIGGRTPCLLGQNNL LPTARDLGWRYDASSPGGRQRWPEKKAGVWDLPLQAIPFPGHTFEVLSMDYNILANQSIN STKAPSYNYPGWRTQATNSYIAGFKRAYETNRAPFFIGNHFEEWNGGIYMDAVERAFKYI AREKEKGGDVRLVSFRQFVDWMDVQPPEVLAKLRSLDVGQQPAGGWKAFLGEAGKGSSAG AGNAA
n-region:MRDISRR
h-region:GLIGLGAGAAAAMG
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29831398|ref|NP_826032.1| MKRTTVAVAAGALLLPLTGCGGDTRAGSGDTVTVTVGYQSKTINTVTAGTLLRSLGSFER ELNSLGDGVTYKVKWQDYATGAPITAQMTAGKIDIGSMGDFPLLINAARGTQLGKPTHLV SVTGYNLRGGLNTIVTAPNSHLASLKDLRGKKVSTSIGSAADGTLVRALRRAGIDPDKGI EKLNQQPAVGASALSAGSADALSQFVAWPGLLAYQGKAKALYDGAELNLPTFHGVTARED FAKRRPAVLQAFLKAQAEATDYLNDHPVTAAEKVAEATGLPAEVVYLYNGAHGIATFDPA LKPRLISALKQDVSVLKSAKLIGNVDVDAFVDDRYAKKALGSSYTAGLTAAPAPAASEVW PKGATRTRSFATPTALLRHLAAHRDGIRAAYVPDATTGTPWFADKAVWVADGDRLLPFVA PATARAYVAGHQGARTVSYAAALARAAS
n-region:MKR
h-region:TTVAVAAGALLLP
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29831533|ref|NP_826167.1| MTARQLVAGLLAATLLTGCAQSVDPIERLGKKAAQKVRRPQEPGAQTYRRWGLSAPLAPA PAPDHPPFPVRTGHRALPPVVDRVATHDKVVFLTYDVTYDGGYYGAEKDPRFTDMVRELR LPVSVFVTDSEVGPGYAHVARLRSVGATVQNGTLGATSLRGLPYAGQRAGICGGRDRLRA RFGRRPYFLRPPAGAYDRTTLRAAADCGVTAVVLWRASMRADGLSYRGRAHRLHRGDIVL AHPGNPDGDSLTTLTARLLRRVQAQGFTVGRLEDYL
n-region:MTAR
h-region:QLVAGLLAATL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29831540|ref|NP_826174.1| MADFSRLPGPNADLWDWQLLAACRGVDSSLFFHPEGERGAARSARENSAKEVCMRCPVRA QCAAHALAVREPYGVWGGLTEDEREELMGRARNRLVSAATNSRDTASNN
n-region:MADFSR
h-region:LPGPNADLWDWQL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29831760|ref|NP_826394.1| MYGKRGAGALAAVALAGAALLLAGCSAPEDNSKKGGGGADIAQRPKGSDPFWVNPEGNAA EQLATYARAGRKDDAEQIRKIAEQPTGEWIGPENPEAEARGYTEAAEKADRTALLVLYNI PHRDCGQFSQGGAADGDAYRAWIDGVTKGIGDRNTTVVLEPDALLHIVDGCTPDEFHEER YDLLKGAIAKLGALKNTKVYLDAGNAGWGHPDQIFQPLQRAGVDRADGFAVNVSNFYTTR DSIAYGKQLSAKVGDKHFVIDTSRNGNGPYTAGKADENWCNPPGRALGETPSTKTADPLV DAYVWVKRPGESDGTCKGGPKAGEWWSDYALKLARASK
n-region:MYGKR
h-region:GAGALAAVALAGAALL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29831844|ref|NP_826478.1| MRARPALPGGLLTAVLTLLSAAVVSGCSQQSGGQAGQPTQGTTSTRPSGYGAVFLAVDEC SSFGTTSFTEVPCTSERAAARVIARYDGKPSDGPACPATTDFVLHISETRPASDEDGDGA VPRGYACMRNLEPPHPGDPGGGGGPRTIVGDCVYGAGRGEVRETSCDGKGRKPPEYRVTS AVPKRSDCPRSTALYVQLGGPTPVGCARPV
n-region:MRAR
h-region:PALPGGLLTAVLTLLSAAV
c-region:VSGC
Superfamily Assignment

PSA tool

>gi|29832162|ref|NP_826796.1| MNINRRQVLLAGGAMGASALLAACSGGGDDTSAASSDKGGKPRKGGTLRIGALGRAGAIT RDPHGTQGNESDYLILALVYDTLTVPGADPNTKPRLAASWEPSKDLKTWRFKLAEDAAFH DGSPVTADDVVWSLRRLRNTPSGAARLPGIKAENITADGKDTVVLVSDYANAELPPLTRL TTFVLKKGTSDKELAKAPGTGPFKLDRYRAGNARLVRNDQWYGGTVYLDAIEVTMFETPQ AMANALLAGQIDVASNAGAVAARTAKSRKDVQVVRRPDDMSMPLVMRTADGPFADARVRE AMRLVVDREAMVKQVLSGYGTVANDIMGTGDPGYAKDVPQRERDLAEAERLLSEAKFDLS KTYELVTTEDISGLAESATLFASQAREAGIKIKVVKQESGAFYEKTWLKGDLYTTYWGTN DSVVFFASKTLVSEAGQNEAGFADKKFDATYRKVIATADPKARAEVLKELQRIEYDRSGY LLWGMADGIDLAASKVRGLPELAGYGRVQLENVWLG
n-region:MNINRR
h-region:QVLLAGGAMGASAL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29832177|ref|NP_826811.1| MNVRRRLIPGTAVAATTLLGLGTLSACSDSTAADGGNGGKLDVVASFYPMQYLAEQIGGK HVRVTSLTQPGQEPHDLEISAQQTVQLEKSDAVLYLKNLQPAVDDAVAQSGVRTKIDAAS LTTLEKHGNEVGGHAAAHDDTKGEESGGTDPHIWLDPVKYSEVAQGVGKALAKADPEHAA DYRKNTAALVEKLDGLDTRYADGLKNTGTKVFITTHAAFGYLAERYGLTEEAISGLDPES EPSGNRVKELEKMAQADGVSTVFYETLVSDKTAKTVAKDARLRTDVLDPIEGITEKSRGT DYFQVMESNLKALRTALGAK
n-region:MNVRRR
h-region:LIPGTAVAATTLLGLGT
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29832312|ref|NP_826946.1| MRNRRAALAVIASAASLALTLSACGQNSEGGSKDEKKSAKGSTVGIAMPTKSSERWIADG ANVEKDLKAAGYKTKLVYGEDDPDTQVSQIENMITQGVSALIIAAIDNKSLDNVLQQAAD AKIPVISYDRLILGTKNVDYYASFDNEKVGELQATYIVDKLGLKDGSKKGPFNIELFAGS NDDNNTKYFFNGAMKVFKPYLDDKKLVVKSGQSALNQVTTLRWDGGTAQKRMDDLLTSTY SKARVDAVLSPYDGISIGILSALKSDDYGSKSKPLPVVTGQDAEVASVKSIIAGEQTQTV YKDIRKLAEVATNMVDSALNDKKPEINDTKSYDNGDKVVPAYLLQPVSVDKSNYKQELID SGYLKASDVQ
n-region:MRNRR
h-region:AALAVIASAASLALT
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29832438|ref|NP_827072.1| MNALRKVGAVAWAAVGSLLLSGCEFNGWYDVQLPGGAAADGHAYHVTVEFRDVLDLVPQS AVKVNNVTVGAVEEVQLDGWHARVRLRVADSVKLPANAVAELRQTSMLGEKYVALSTPPG TAPVGRLGDGDRIPLSRSGRNPDIEEVLSALSALLNGGGVAQLKTITVELNKALDGREDR VRSLLKELNTFIGGLDGRRKDIIHALKAVDRLAGRLGKEKKTIAQAVDTMPPALKVLADQ RRDLTRMLTALSKLGTTGTKVVNASHDDTVANLKQLRPILQQLNKAGADLPNSLELLTTY PFPRNAVDAVRGDYVNLDITADLDLSALYRNLAGGSDKSGGGNGESTQPETPDIPDLPDL PTVPTPTALPSAPSLPSSPSMPSAPSGGGGPLCPPVCTSSYTTRGEPPEGIDLALAELML KGVQP
n-region:MNALRK
h-region:VGAVAWAAVGSLL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|29832469|ref|NP_827103.1| MRAVRLSVVTAAATAAALTAVTGCTEKSTASGSDAIQVTAADSKCETSTKSVPAGQVTLK IENKGSKATEVEIVFPDDRIVSEKENIGPGTKYTLTAEVKAGSYEIACRPGMKGHGVRQK LTVTGGKVAKRDPRLDKAVAAYREYAQEQADETLPKAEAFAKAVKAGDIEAAKKEFATSR LGWERTEPVAESFGDIDPKVDVREDGLEDGQDPATDWTGWHRLEKSLWQDKKIGDREKKL ADQLVTDLTDWQKRVGKAEITPSSMANGAKELLDEVATGKVTGEEDRYSHTDLSDFKGNV EGAQKAYELLKPVAKENDAALATELDKQFTALNTLLDKYRTDKTSYDFTSYDKVGKADRK ELSDAVNALAEPLSKLAAAVVK
n-region:MRAVR
h-region:LSVVTAAATAAALTA
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|29832507|ref|NP_827141.1| MPTHSSGLARYWHTAFVACLLALALALTGCNPHMYDEVPALHDVKRAEVSGSWIGYDRTN VVFRPDGKADIRLLDGQEWDFDDRWRLSGTGTWKLTDKRTGWNDGQHVQLTLTSRTAVAT RAPEPNEPLDPSADRPETPKTYTWTFELRRDDKEALKLYFFFGDPDSRSTYILQTDAP
n-region:MPTHSSGLAR
h-region:YWHTAFVACLLALALA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29832532|ref|NP_827166.1| MRLTREKLVAGAAVALLALTGCGGSSGSDDGAAKAVPATATGSLEDLAAEVKCKPDIQTD ADEIRQAVCKSTSRKFILATFATDRGQREWLNEAKDYGGFYLVGAKWVAVGDQKVVKTLR GQLGGTMEEGTSHASHSSGTGSDASHEGTHSGHSG
n-region:MRLTREK
h-region:LVAGAAVALLA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29832592|ref|NP_827226.1| MNHSPRNRTVVSCTLLVIALGAAGLTACTSDGHPLSAKPYDAAGQIAFNAPVGDSKKADP DKPLEITASGSDGRITDVTATDASGRYVAGELAADGSRWHSTSPLAAGSRYTVRVSTEDE DGAPGRKDITFTTSVPKTKKELGVAFGPEAGTYGVGQPVTATLSAPVKDKAARTVIERAL KVDSKPVVEGAWHWVDDKTLHYRPKEYWPTHATITAHSNLKGVKVAERLWGGDVKPLKLT TGDSLIAVTDAAAHSMTVFRNGKEINQIPVTTGKAGFETRNGVKVVLGKEYFVRMRGTTV GIAEGSSDSYDLPVYYATRVTWSGEYVHAAPWSVGSQGSANVSHGCTGMSTSNAEWFFDT VREGDIVKVVNSNGDNMDPFGNGYGDWNLDWKNWRTGSALMAGTPDGPSPADRAKLRPET V
n-region:MNHSPRNR
h-region:TVVSCTLLVIALGAAG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29832606|ref|NP_827240.1| MAGRGRTSGVLASCLLLLAALVGCGGRPARDASAAEVQRVLDRRAAAVLHRDRSAFLATE SPVAPAAGQLATGAEEFGNLRGVPLASWSYRVTAFHRSGERATATAELHYRLKGYDRAPV TAGRMLRLTRGDGGWYVVSDEPAKKSSEQLWEQGAVRIVRGEHSLVLGVGQPDSVLRGYA NLADRAVPAASQAWGADWAGRVVVLVPKSLDGMAGLLGAPASGYRGIAAVTTGEAGGAAK APADRIVVNPDAYGVLGDFGRQVVLTHEATHVATRAHTTAATPLWLSEGYADWVGYRGSG RTAAQIAPELDRAVREGQLPAALPADADFGFSGDAGKLAKAYEGGWMACRMIADHWGEVR LDDFYRAVGDHRKRAGAVEGALKDVLGTTPRKFTAQWRAYLKAQLG
n-region:MAGRGR
h-region:TSGVLASCLLLLAA
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|29832743|ref|NP_827377.1| MTLSRTATRAEHCVIACAEAWRDAGEILAAPMGPVPSVGARLARRTFSPDLLLTDGEALL VGPDGTPEGWLPYRQHLALVTTGRRHVMMGASQIDRFGNQNISCIGDWAAPARQLLGVRG APVNTLNNPTSYWIPRHSKRVFVERVDMVCGVGYDRAAEHPGTARFHHIPRVVSDLGVFD FATPDHSMRLASLHPGVTVEQVRAATGFELTVPDGVPFTREPTPAELRLIREVIDPGNSR DREVRT
n-region:MTLSR
h-region:TATRAEHC
c-region:VIAC
Superfamily Assignment

PSA tool

>gi|29832766|ref|NP_827400.1| MIVRHRSLLILTTVLTTGALTLTACGSRDDDKGSDSGSKTTVVIGVDAPLTGQNSATGLG IQYGVQIAVDDANKKNLVPGVTFKVKALDDKAVPASGQQNATALVANKDVLGVVGPLNSG VATQMQQVFDTAGLVQISPSNTAPELTQGKNWQSKKERPYKTYFRTATTDALQGGFAADY AYNTLKKRKVFIVDDKQTYGAGLAKLFKQNFKKAGGKVTAEDHISVGDTDFSSLVTKVKN SGADLFYYGGQYDESEKITKQLKDGGVDIPLFGGDGMFSDTYIETAGKPSEGDLVTSVGV PVTTLPAAKEFIATYKAKKYPGDYGTYGGYSYDAATAIIKAIGNVVKDGKVPSDARTKIV DEVQKTKFDGIAGPVAFDEYGDTTNKQLTVYQVVKGKWKAVKSGTYNAG
n-region:MIVRHR
h-region:SLLILTTVLTTGALT
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29832899|ref|NP_827533.1| MRTQSRRRPRATLAMAAAGTLLAPLLSGCWVGAGGSGSGGDSINVLMVNNPQMVELQKLT ATNFTKKTGIRVNFTVLPENDVRDKISQDFANQAGQYDVATLSNYEIPIYARNGWLHSMD GYVRGDTAFDQQDILKPMRQSLTGDDGRLYGQPFYGESSFLMYRKDVFAEKGLKMPAHPT WEQVNKLATDVDGAQSGMKGICLRGLPGWGEVMAPLTTVVNTFGGTWFDKNWKARLDSPE FEKATRFYVDLVRAHGESGAAQSGFAECLNNMTQGKVAMWYDATSAAGSLESAKSPVKGK IGYVPAPVEKTRSSGWLYTWAWGMQKASRNPDKAWKFVSWASSKEYEQLVGDTVGWSDVP AGKRASTYTNPDYRKEAGAFQEMTREAIEGARPTDPGVQPRPAPGIQFVGIPEFTDLGTK VSQEISAAIAGRQSVDSALKKSQKLAEQISKEYEGR
n-region:MRTQSRRRPR
h-region:ATLAMAAAGTLLAPL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|29832942|ref|NP_827576.1| MKTVLGRRSRILAATTATAGLLLVAGCSSDNGGGKTTVKGVPLVKAGQITTCTHLPYPPF QSEIDGKVQGFDVSLIDLVAKDLGVKQAIVDTPFENFKTGAFLNSGQCDVAAAGMTITEE RKKNVDFSDPYFEATQAVLVDKKSGVDSLADVKAKGKKLGAQAQTTGEEYAKSKGFDAVS FESSDAVLNGLRTGQVQAVIIDYPVVQGWLKDKANADAFKVVDNLNTGEEYGFTVKKGNT KLLAEINKTIKQAKADGTYKKIYEKWIGPYTASAATASPSAS
n-region:MKTVLGRRSR
h-region:ILAATTATAGLLL
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|29833059|ref|NP_827693.1| MTIRPTRRTLLGTGGAVALLAGCSKYGDSNNSSSQSTSGTPSGSPSGTASATASGGAAAG PELAKTSDIPVGGGTIFKDEKVVVTQPEQGEFKAFSAVCTHQGCTVSTVSDGTINCPCHG SKFRITDASVAAGPAPRPLPAEKITVEGNSIRLT
n-region:MTIRPTRR
h-region:TLLGTGGAVAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29833087|ref|NP_827721.1| MSTSSRPRRRIFIPFALITSAAVLLTACGSGDSEGAGKSDAQAAAKTGGIPTADVVSAVR KNEAAAKLLPSGTRSLTVAISVGGTPPGTSYLDDGKTLAGQDVDFANAVGKVLGIKLKTE SASFEAILPALDSGKYDFGASNFGVTDERRKTIDFVTYINDGQGFATREDSKLQKITDLK QLCGLNVATGAGTTFEATLEENKKVCTDAGKKAYEVQTYNESGAIWSSLQQGRSDIVMST INGLRYAVAQQQGLKFLNEFHRLDVGFAFKKGTKLAPAFQAAVNELIADGTYEKILKKWG TTGSAIEKSQVSPPELKD
n-region:MSTSSRPRRR
h-region:IFIPFALITSAAVL
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29833199|ref|NP_827833.1| MHRRSRRTLQLAAATTLLVTGLTACNAAAKNDASGTAKSGGKSFTLVTPDGVGQNEFLKL AVDGVKAAAEAHDGTQKVYQSTDTSSQQQNVQAAVDAEPDVIVLVGFEFADVVAQQAKAH PEQQFLIVDACTTKTYRNVSCAVFREHEGVYLAGAEAGLLSRSGKVGAVDVLDTPQFRRY SDPFAAGAKEVAAKTSASTRFVGGQSPFDDSARAKEQANSLLAKGYDQIMAAAAAGNYGV FEAAKAKGAYAYGVDVNQCVAAPGTVVDNVIKRTDVAVRKGIDQVLGGKAGTTVSYGLKE GGISLTGLEDGVATSKCVIAQHKDVLKKVTALRDRIVAGELKVDDPAAE
n-region:MHRRSRR
h-region:TLQLAAATTLLVTG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29833211|ref|NP_827845.1| MNRKTLVLPAVVGLLAPVLAACGGSDSGSSGGGSVVVGTTDRFTASSDAPAPVDPAYAYD VGTWNILRQTVQTLMVQPRGDGEPEPEAAESCGFTDTGNERYACKLRKDLKFSSGKAVTA ADVKFSIDRARSIKADSGVFALLSTVDTVETQGDREVIFHLKTADATFPFKLSTPVAGIV NPDDYEKDKLRDGFKIDGSGPYTMEAEEKDNELVKAVFTKNPNYKGALKVKNDEVEMRSF EDASAMGAALSKGDIDLMTRTMTPDQIQKLSTDSKGDVNLVEMPGLEIRYLAFNTDATTV KTKAVRQAVAQLVNRGELVSKVYGSTAEPLFSLVPATITGHSNSFFNKYGDASVAKAKSL LARASITTPVKLTLHYTTDHYGSATKTEFQQLQQQLNNSGLFDVRIKGEPWSTFRPAEQK GKYDVYGMGWFPDFPDADNYIAPFLDKDNFLGSPYANSEIIGNLIPQSRREADRLTASKS ITDIQDIVANDVPVLPLWQGKQYIAAQDDITGAEWALNSSSTLQLWELGRGVSD
n-region:MNRK
h-region:TLVLPAVVGLLAPV
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|29833212|ref|NP_827846.1| MNMRNQWPVLSVATGLAAGLLTGCGSDTGDSGGTGSEVVMGMSDDVLATDPASGYDPGSW LLFNNVFQSLLSFPKGGTEPEPEAARECKFTDTETKVYSCTLRDGLKFSNGDALTSKDVK FSFDRMLKINDASGPAIMFPMLDRVETPDAKTVTFRLKTPDATFPSKIASGAGSIVDHNS YSATGLRKDGGAVGSGPYKLDSFDDDKAVFSVNDSYKGTAKVNNSGVTLTFFHGNQTALK NALLNNEIDAAYRGLAAADVADIDNDTSTGKGINVVEGTSAEVQHMVFNMDDPVAGKLGV RKAIAYLLDRDALVNKVYDNTATPLYSIIPAGIAGHDTSFFDTYGARPSKAKAAAALLAE GITGKVKLTLWSTPSRYGPATDEEFRTIAGQLNASGLFDATVKSVAYSQYEKDIAQGKYG VYVKGWVPDYPDPDNFTAPFFGKGNVLSNNYSNSTITGQLIPKTAAQSDRASTDAEYGRL QDIVAEDLPVIPVWQAKQYAVVRDNVYGLEYCLDASTVFRFWEISKG
n-region:MNMR
h-region:NQWPVLSVATGLAAGL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29833228|ref|NP_827862.1| MRRRSVLLAVPAGLVTLAGCGDEKSDTAKTKPSTSPSPSASASSAPPPKIVDGPLPAITA GTKFDEKPTVAKGSGDPSKDVAVKTVIAGSGKTVAENDYIQANYLGQVWDTAKVFDNSYD RKTPLVIQLAQGSIIDGWRYALAGKKAGSRVLMSVPPTWGYGKQGNSQAGIKGTDTLVFV VDIQNTFNAKSSAQGKDVAQGDAKLPKVGTNTDGKAPSIDVPKTAAPTKLVANYVIEGDG DVVKADSSVLVQYKGVLWDTGKEFDSTYSRSALTSFSLQQVVKGWSQGLTGKKVGSRVLI VVPPKLGYGDSPPSGSGIEKDSTLVFSVDILAKM
n-region:MRRR
h-region:SVLLAVPAGLVT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|29833290|ref|NP_827924.1| MISERDDVTDIERVGVVGCGQMGAGIAEVCARAGLDVKVAETTGEALEIGRTRLFNSLSK AAERGKISEEERDATQARLSFTTDLGEFADRDLVIEAVVENEQVKTEIFQVLDQVVTRPD AILASNTSSIPLVKLAVATSRPDQVIGIHFFNPAPVQKLVELIPALTTSEGTLSRAQGLV EKILGKHAIRAQDRSGFVVNALLIPYLLSAIRMFESGIASREDIDNGMELGCAHPMGPLK LSDLIGLDTVASVASSMYEEYKEPLYAAPPLLQRMVDAGRLGRKSGSGFYSYA
n-region:MISER
h-region:DDVTDIERVG
c-region:VVGC
Superfamily Assignment

PSA tool

>gi|29833333|ref|NP_827967.1| MRNTAKITTAVLAAGALTLGLSACGSDKDSASDTSGPLIVAASPTPHAEILDFVKKNLAK KAGLDLEVKEVTDYVTPNTATEDGSVGANYFQNQPYLDDFNKKKGTHIVPVVTVHLEPLG LYSHKVKKADDLKSGATVAIPNDTVNEARALKLLDANGIITLKSGVGNEATPGDITKNPK NLKFKELEAAQTPRSLDDVDAAVVNGNYAISSGLKPAKDAVVLESPKDNPYGNFLAVKKG NEKDPRVKKLAKLLTSPEVKKFIEDKYAGSVIPSF
n-region:MRNTAK
h-region:ITTAVLAAGALTLG
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29833334|ref|NP_827968.1| MRKPVISAAAAALALGLGLTACGSGSDSDSAKSGGDGDALVVGATAVPAGEVLAYIKKDL AEKAGLDLEIKEFTDYVLPNTALQEGELDANLYQNQPYLDDFNKAKGTDLVPVVKAYLPP MGVYSKKVTDVTKLADGATVAVPNDTTNEGRALKLLASKGVIALKAGAGTDASPADITSN PKHLTFKELEPAQLPRSLDDLAAAVINNNYAQDAGLSPTKDAILLESAENNPYANLLAVK KGNEDDPRVEKLAKLLTSPEVKKFIEDKYRGSVLPVVSG
n-region:MRK
h-region:PVISAAAAALALGLG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29833393|ref|NP_828027.1| MGMRRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEV VLGLPRSLKGGEGPAAVKVRAFAQELARVIAPVPVRLMDERMTTVTASQGLRASGVKSKK GRSVIDQAAAVIILQQALESERVSGKAPGEGVEVVI
n-region:MGMRRGRR
h-region:LAVDVGDARIG
c-region:VASC
Superfamily Assignment

PSA tool

>gi|29833424|ref|NP_828058.1| MLLRSVPRVLAGLFVCLAVLLTGCSPTGPTKAPASSARPSWAAGMATVKESQLPAEARQT LARIDRGGPFPYAMDGAVFGNFERLLPRHQRGYYHEYTVKTPGSRDRGARRIVTGQSDEI YYTDDHYKSFRAVLR
n-region:MLLRSVPR
h-region:VLAGLFVCLAVL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29833493|ref|NP_828127.1| MSSTPETRPRGPQVVIIGAGIVGCSLADELTARGWTDVTVLEQGPLPAPGGSTSHAPGLV FQTGPSRMLTSFAQYTVEKFNSLEADGVPCFDPVGGLELATTPERLADLHRKAGYAASWG VRGEIVSTARCKELWPLIDESVVLGGFHTPDDGLARALLAARAQMERATSRGAVFLDRHT VTGIERQDGRVTAVVTDRGTFAAHHVVSAAGFWGPVIGRMAGIDVPLQPLAHQYAKTPKL PELAGATAEASKPILRFQDRDLYFREHTDRIGIGSYAHRPLTVDAFAIPAYDEARANDME MPSSYPFTAEDWAPSWEDCRRLFPALRDTEIEEGFNGVFSFTPDGMPVLGESRALRGFWL AEAVWVTHSAGVAKAVAEWMVDGRPSIDVHEADLTRFEDAQRSPSYVRERGAQQFVEVYD ILHPLQPMERPRPLRVSPFHARQQALGACFLEGGGWERPHWYEANAPLVDALGPLPERDA WSARYWSPIAAAEARATREKVALYDMTPLRRLEVSGPGALDFLHRMTTNNLRKKPGAVTY TLLLDHTGGIRSDLTVARLGPDRFQVGANSPADLDWLTRHAPDGVHIRDITSGTCCIGVW GPLARDLVQPLTRDDFSHEGFGYFRAKETYLGHVPVTAMRLSYVGELGWELYTTADLGLR LWDTLWEAGRKHGVIAAGRSAFNSLRLEKGYRAWGTDMTDEHDPFEAGVGFAVRMDKEFV GREALDAAAPPTRRLTPLLLDDPAANVLGKEPVYVDGVPSGYVTSASYGYTLGRCVAYAW LPPLATGTGVHIEYFGEKVPATVAEEPLFDPKMTRIRR
n-region:MSSTPETRPR
h-region:GPQVVIIGAG
c-region:IVGC
Superfamily Assignment

PSA tool

>gi|29833555|ref|NP_828189.1| MHRTTTTATLLVTAAVTVLSGCVTVQRLPAPAPSVAPPHPSVPRPDGSGDPQVVQAPARE ALELIEPSHRPSPTAAAPHRTPPPARAAAPVTVPRRPHADPPAKPAHPEPRDAVPTSVSK LVPKDGDVCALGRKYGGWQPDSPEATICKNAYGR
n-region:MHR
h-region:TTTTATLLVTAAVTV
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|29833813|ref|NP_828447.1| MRISRRTFAAAAAVAVVLPLSACGSGDDGGGSTDASGKVEGTITFQTWNLRANFKSYFEG VVSDFEKKYPDTQVKWVDQPAEGYADKISADAAGGTLPDVVNVSPDLVAPLAKAGLALDL DKAAAKYRKEYLPGAWASHRIPGMTGTYAFPWYLNTGPLFYNKSLFKDAGLDASKPPKTY DELFADALRLAKKSKGEVATLANVPTIEDFGRYGVELMNKEGTAFAFNDTKGVELLTKYK ELYDAKALDPQVLTATPESSGKKFLTGAVAMNPGSALDLGNFKKQAPNLYKNIGITDQIT STGKVNMYVMGVMVNSRSQRKPAAVAFAHYVTDAQRQMSFAKKVAIFPSTAGSLDDPYFT KEDGTDETRVRIAAAASLKNAVNYTPVLFSEQMKTALRNEVAKALQGKESPKAALDNAVK ACDRLLQQQG
n-region:MRISRR
h-region:TFAAAAAVAVVLP
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29833821|ref|NP_828455.1| MAGRTLWKAAAAAACATLALSACGSTKDTAASGGAGGGTGKVGVILPLLTSPFWQSYNDY VPKMAKSEGVDTLKTVNSNSDPSQQITDINNQLNQGVKGLVVAPLDSAAIEAGLDQADRK GVPVVAVDVAPEKGKVAMVVRADNVAYGEKACQYLGEQVTSGKVVQIMGDLASVNGRDRS EAFRTCVRKNYPKLKVLEIPAKWESDTAASKLDTLLNANPDIKGIYMQAGGVYLAPTLQT LKSKGLLKKTGEKGHITIVSNDGIPQEFDAIRKGQIDATVSQPADAYAKYGMYYIKAAMQ GKTFKPGPTDHDSTIVKLPSGILEDQLPAPLVTKDNVDDAKLWGNTVK
n-region:MAGRTLWK
h-region:AAAAAACATLA
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|29833871|ref|NP_828505.1| MRRRLLALLCVFASLLTACGALPGEGTGRRTVTVWLMKDSASKEFLARFTKEFERAHGDL RLDIRIQQWTGIGEKVQTALRRQGGDGPDVIEVGNTQVAQYVDGGGLLDLTLESLRDWGM NDWLPGLAEPGRFGSRQYGIPWYAANRVVIYRKDLFAAAGLAGPPKTRDQWLADTQKLNS HDVQGIYLAGQDWYTLAGFIWDEGGDLAEQPSSGTWEGSLDTSAALRGMDFYRRLQALGT GPADADEEHPPQAGVFARGRVAQIVAVPGLAQAVVRKNPDLRDKLGYFPVPGRTAARPGA VFTGGSDLVVPKNTDDRRGATAVVAALAGGKWQTDLARTMNYVPNKTTLADAVEGEEGVA AMAAGAAQGRATPSSPDWAAVEADNPVKDYMTKVLTGADPATEARRASRRITRTLS
n-region:MRRR
h-region:LLALLCVFASL
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|29833950|ref|NP_828584.1| MTWRPALAGLLLLTGCTTGPSLENRDEVTAPPGDSRHLTIGSAGFTESDLLAQMYALLLE RAGYKTSMLTVANRELYEPALESGQIDVVPEYAATFADWLNAKTHGTDAPAVGSPDQNAT MSALRKLAAPRGLTVLDAGRAVDQNAFAVTKAYARQHHLKTLSDLGGSGLKVRLAAGDEC VQRPYCEPGLKKTYGIDITAVDPKGVGTTQAKRAVQSGQDQMVLTTTTDATLDEFGLVLL ADDRHLQNADSIVPVVNRAQAGSERVTGALDRLNDVLTTGDLAAMNQQVDSWRRLPKDVA RSYLTEKGLLK
n-region:MTWR
h-region:PALAGLLL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|29833988|ref|NP_828622.1| MTRRVRLIVLAVGGAGLAALLVAACLRLPGFGGTRHPYGDRVVRASLARHTANTIASVNF DQRAFDTLGEMGILFASVLGTVVLLRQTRDERSARPEPEDVALPVRRYALVVLPVALLTG LYVIAHGQLSPGGGFQGGVIAATALHLLYLGADYRALERIRPVGLYEIGDALGACAYLVL GLTGVVAGTSFLANTLLPYGTFNTLSSGGTVPLLNAAIGVEVACAVVVLLARFLDQAVEI EEGSGK
n-region:MTRRVR
h-region:LIVLAVGGAGLAALL
c-region:VAAC


References

  • Madan Babu, M. and Sankaran, K. (2002) DOLOP - database of bacterial lipoproteins, Bioinformatics. 18:641-643. PDF
  • Madan Babu, M., Leena Priya, M., Tamil Selvan, A., Madera, M., Gough, J. and Sankaran, K. (2003) An updated version of DOLOP with functional assignments to predicted lipoproteins, Journal of Bacteriology, in press.

 

This website is Maintained by M. Madan Babu * and K. Sankaran #
* MRC-Laboratory of Molecular Biology, Cambridge - CB22QH, U.K
# Centre for Biotechnology, Anna University, Chennai - 600025, India

This site is dedicated to Prof. Henry. C. Wu
Last modified : 14th April 2005