73 predicted lipoproteins out of 4683 predicted ORFs for Photorhabdus luminescens ssp. laumondii TTO1


Functional assignment
Protein sequence
Signal peptide features
Superfamily Assignment

PSA tool

>gi|37524121|ref|NP_927465.1| MKFVKYFLVFVVSCIFLGTASIFGMYKYIEPQLPDVATLKDVRLQTPMQVFSADGELIAQ YGEKRRMPLELPEIPPIMVKAFIATEDSRFYEHHGVDPVGIIRAASVAMSSGHASQGAST ITQQLARNFFLTPEKTLMRKVKEAFLAIRIEQLLNKDEILELYLNKIYLGYRAYGVGAAA QVYFGKSVNELTLSEIAMIAGLPKAPSTFNPLYSYGRAINRRNVVLSRMLNEGYITQQQY NQARSEKLVANYHAPQIAFSAPYLSEMVRQEMIERYGENAYTDGYKVYTTITRKLQLAAV DAVRNNLIDYDVRHGYRGAQEVLWKVGEPAWDREQIVKKLKTLPSYGALMPAVVTKAGTD QAIVMLPDGSSVELPIAGVRWAKKFKSDSAQGAVPRSVNEVVQVGEQVWVRKVKDIWWLA QVPEANAALVSIDPNDGAVKALVGGFDFNLSKFNRVTQSLRQIGSNIKPFLYTAAMDKGL TLASLLNDLPISRWDAGASTDWRPKNSPPAYVGPIRLRQGLGQSKNVVMVRAMRAMGVDY AADYLQRFGFPAQNIVRTESLALGSPSFTPMQMVRGYSVMSNGGYLIDPYFITKIENEDG DVLFEAKPKIACPQCDIPVIYGDTVRSIELSENSIENVAQSHVGQQEILPLPELERAPVI DGREGAQEYAPHVISTQLAFLIHDALNSNIFGEPGWSGTGWRASRDLKRRDIGGKTGTTN SSKDAWFSGYGPDIVTTVWIGFDDHRRSLGRTAASGGEAGAKSAQPIWDDFMKIALEGVP EKEVTPPPGIVSAVIDRKTGKLAGGGGDTRSEYFIDGTQPTESAVQEVGTILIENGESQE LF
n-region:MK
h-region:FVKYFLVF
c-region:VVSC
Superfamily Assignment

PSA tool

>gi|37524131|ref|NP_927475.1| MVAPFWKRAYLALLSSTFVLLLASCDNNRSLPKTPEKPMAHIPNKVPSEAATAGNFQAVI HLVDIAKLSQSPTTNRDYSTNTLYLWNDKNCDALASLSSSWNDTSATPTGSDSYGPYWVI PLTKNEGCINFIVRDGNNNKLIDSDLKISFSDFSNRTVSVIPGNYQIYGSRAAAFNSVFG VSQASAHWVDNQTLLWSGGADKPYVRLYYNRNGKVEANDEGNFIDSYLTLTPTTLSQKTA ERFPHLKKLTAFHLPEDTDVDTLLTGELVALATNEAGLLLSATQVQTAGVLDDRFANVAD TLEYGALINDTGVTFRLWAPTAQHVGLVIYDANKQIIANHAMKRDPASGSWSWQGDKELV GAYYRYALTVYHPYSRHVEHYEVTDPYSHSLSTNSEYSQVINLDDEALKPQNWDSLIMPR SQNTPADIARMTIYEAHIRDLSVADGTVTETWRGKYLALTADNSDMFKHLKTLSQAGVTH MELLPVFDVASINEFSNEVADLNHPFSRLCQVNPRVKNSRFANYCSGSQTVGEVLQALQR GDNANNPQVQELNAMIAETDSYNWGYDPFHYSVPEGSYATDAEGSVRINEFRAMIQAIKQ QLGMNVIMDVAYNHTNAAGPAHRSSVLDKVVPWYYHRLDEITGNVESNTCCHDTAPEHRM FAKLIEDSLVTWVKDYKIDAFRFDLMGYHPKAQMLSALAKVRAINPSVYFFGEGWNSGQD DRFEIASQINLKGTGIGTFSDRLRDAVQGGGPFDSADTIRINQGVGNGAGTLLNEMAWLD ANETRHLADLVRLGMAGNLADFVLINKDGAVKTGREINYKGAIAGYAADPIEVINYVSKH DNQTLWDIISYKAAREANLATRVRMQAISLATTFLGQGLAFAQHGSELLRSKSFTRDSYN SGDWFNRVSYTYQDNNYDVGMPDQRVDGENYALIEKVKNVVDKPGRTELLQMTAFYQELL RLRQYSPLMTLGDGTSVKQRVDFRNVGPHQQLGLLVMTIDDGNTTGDDRDSRFDGLVVMI NAAPYPATVRDLNVKGLKLNDIQRELGHTSLAAGTRIAKDGTVTLPAWSVAVLVLPQDGK RGIGLPVRRK
n-region:MVAPFWKR
h-region:AYLALLSSTFVLL
c-region:LASC
Superfamily Assignment

PSA tool

>gi|37524141|ref|NP_927485.1| MNKKLTLPNSFAVSVFLAVLAACLNLILWRADILEMAHSIPLKGLMIIWYILGWGFAPGC LTVLTINSIRGRLPRRVGAVVVTLISFLLVTGICGLVYAYLTNSVFMQIAMGGEAHHHSS VNHGTILGFITQLLPSLCATVISIVNAFSIKMGKQFR
n-region:MNKK
h-region:LTLPNSFAVSVFLAV
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37524307|ref|NP_927651.1| MKNNKLILFCVTLGWLLISGCTSIMTHSGPSRGYYPGAKANIEMLKDKDTGWVMKPLLAI DLPFSALLDTLLLPYDYIKSDEDQSTSSPKERIEKIEKAQRQTKTN
n-region:MKNNK
h-region:LILFCVTLGWLL
c-region:ISGC
Superfamily Assignment

PSA tool

>gi|37524509|ref|NP_927853.1| MKIVKQLRRRYQAASISLVITLSLSLISCHKQKPGPLPTQQSAKEGQQLIDFGEPNLALL ADKLHNSRHNQLHFVQIGDSHTAADFFTGKLRSLLQQRFGNAGIGFVSPINVPGQRNAMV SMTDNKQQWKLTTSRKDNRPDFPIGGTIAEPNSQISQLILRLFAPSHDRYQLKTLYQASD DAQILVQSATKRILKLPATHDHWQFSTEESVTFPVNIMAIQNNQLKLGGWFINRKQPGVM LSALGINGATINMMDKWQPEWIDTLVQMHPDMMILAYGTNEAFNHSLDLPSYRQQLETKI KQIRNQLPQTVILIIGPGDSLKNNQFTSCIAQQSTMLDNIIHIQQKVAQDQHTLFWNWRA YMGGKCSIRRWAQQDLARPDYVHLSAAGYERSAEALYQQLIDALGQ
n-region:MKIVKQLRRR
h-region:YQAASISLVITLSLS
c-region:LISC
Superfamily Assignment

PSA tool

>gi|37524517|ref|NP_927861.1| MKLRLWITALTLVAGCQGTFSSIAPVQPDLNSETTAEATRAWPVLAPIPSPEGLRACCAF GYNLKTELLTIPVPFYHISNVLDADNLGAHNYNNSFFGTVASLTGLSNEKVGMIYTRRGG FIDISHVRDTADNAVFLFSQIWPRLGEEWQIELSSELALRRIQFYQFTPPASIEQRYTLT AYLAAKLAFELAAWHEIAQWYGYQSVPGFSEKVSAFSPEDLYSNLLGARLSLSLILAGQV PSMKQYRLSMQAILPPALRELEALSPDETRKMFEQVDGIWWDSKRRVPDKRLILQRDFHT HSDRTPNMVPTEQQVPLRLTLPQQYTGYRLSELAELQLWPSRQMKDLPVPESYWIALDFP QLAEKAKEQQENH
n-region:MKLR
h-region:LWITALTL
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|37524649|ref|NP_927993.1| MKYWGKYLLCGTVISLLVGCHSRPTAQGQQYRDGHIAQDLRLVNQPNAQGKPVNAKDFSE QVALISQSAPRLYNRNSLTFDAVQNWMLAGGETSKLHLFNLRAYQMEGVDNYGNVQFTGY YTPVLQARRVKQGEFKYPLYRMPPKSKYRLPSRTEIDNGALSPSLIIGYSRSLIDNYIME VQGSGYVDFGDGGPLTLLGYAGKNGHIYRSIGKLLIERGEIAQEDISILAIRKWTESHSE AEVRELLEQNPSFVFFKPENYAPVRGASSVPLIAKASVAADKMLIPPGTTLLAEIPLLDR EGKFTGQYQMRLVVALDVGGAIKGHHFDIYHGIGGEAGIAAGFYNHYGRVWVLKKAQPTM LMVSQ
n-region:MKYWGK
h-region:YLLCGTVISL
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37524695|ref|NP_928039.1| MRRLLASLLALSITGCSVQQATFPDASQLSDMKYTKLSTGEKKHFSSSVKLYTKSEELLG VSFKDLGIVSGQSCRSSLQDPPANIIVARNQMMTKAAYLNANAVLLHQCEILSGQGCYQI AICEGSALLITQ
n-region:MRR
h-region:LLASLLALS
c-region:ITGC
Superfamily Assignment

PSA tool

>gi|37524696|ref|NP_928040.1| MSVKLKTIATISALLGSLILSGCGQEKQDPNHIKVGVIVGAEQEVAEIAKKVAKDKYGLD VELVTFNDFVLPNEALSKGDIDLNAYQHKPYMDQQIKDRGYKMVTVGNSFVYPIAGYSKK IKSLDELQDGSQIALPNDPTNLGRSLLLLQKQGLIKLKDGIGLLPTVLDVVENPKNLKLV ELEAPQLPRSLDDQKIALAIINTTYASQIGLTPAKDGLFVEDKNSPYVNLLVSREDNKDA ENVKKFVKAYQSDEVDEAANKIFNGGAVKGW
n-region:MSVKLK
h-region:TIATISALLGSLI
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37524895|ref|NP_928239.1| MRKMLPLMLAVTLTGCTAHSKQADIDSYTSKKINEIIENQVKPGNKENPGEIIKDVSYQF LGTPYAANKLIGSPTEPEKLVIDFNGLDCFTFLDYVESLRKSNDQSDFVKNLIQTRYIDG KIRFLQRKHFLTDWSTREKLNAKDVTDEISSSYIAITKSLNKKADGSEYIPGLGVTKRDI KYIPGDKINDAVIKNLKTGDYIGIYTHLAGLDVTHTGIFIMTDHGPMLRNASSLAANKKV VDSPFLDYVKNKPGIIVLRAL
n-region:MRK
h-region:MLPLMLAVT
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|37524931|ref|NP_928275.1| MKTKAILFASVLLVGCQSGPDWSTTAGQRAQNSSSTSLKTGKIATDNTNQLAAYWGEGDS GAQHELWGYIRDELKMKIPDNYRVREQRNYYLKNKSYLHDVTLRAEPYMYWIVRQIKQRD MPMELVLVPIVESAFNPHATSHAKAAGLWQIIPDTGRNYGLTQDKWYDARRDVAASTTAA LNLLQRLNKMFNGDWLLAIAAYNSGEGRVMRAIKENQIKGKPTDFWSLSLPRETALYVPK VLALSDVIRNSDKYGITLPKSNNQRALAQIDVGQQITLSQAAELAGMSLTSIKAYNPGYK RGVTSPNGPHYIMLPKAKVNQFKNSLANKTVLSNIRQEVAKNNHRLSKQSQYKVRSGDTL SAIAKRFNISTRELQRLNNLKTARLLKIGQLLRVNNDNAIIYRVRQGDSIASIAKRHGIN IKDLMNWNDGIKTTDIKPGIELTLYINEYYDEA
n-region:MKTK
h-region:AILFASVL
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37525034|ref|NP_928378.1| MKNPVFFSLSWVLVMVLAGCAGQTQEATASGVSFHRSHQASPAVSDIYSLTPEVTRYDRY TLVSVGSQAVQREPLNQIINITMPVPLVQRIGDGLHYLLFGTGYSLCDTTATHFVKLIGR PLPAIQRKMGPIRLSEALQIVVGPAWRIRVDEVNREVCFVLRDEYRQFSETTVGRITQPK MRVPLQIASSPALSASTLSNSTLATPLPVKPLIAERPKTDTLQSSVTGGKSTTISSVSPT QPIKSLLSGSTPVATVPIGNIWRAETGTTLRGTLERWANTTDCPVGGHWVVVWSSPTDYR IDAPLMFKGNFESLLVQVFDLYRQAEKPLFAEVSRLQCLISVSDKPVTR
n-region:MK
h-region:NPVFFSLSWVLVMV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37525042|ref|NP_928386.1| MKTLIAVSFPTEYTPLVMMTLFVIGCVLLSPVSKFLQEYGLLMCSVHPVPRIAICLYVMS GTLMLLSPAPLMERIAALLLLSFLLQLSVMDVLSGWLPRQFTLACLVSGVLVNISLPSVS ITLLATVLMLAGMGVLRELMNRHSQCEVLGMGDVWLMGALSAWLTGLPALIGCLMGLSGF VLWHLAQLPHQGTKGGPLGPWLSLGSVVMLLERLYQPIWVI
n-region:MK
h-region:TLIAVSFPTEYTPLVMMTLF
c-region:VIGC
Superfamily Assignment

PSA tool

>gi|37525135|ref|NP_928479.1| MKKLLALFVIAPILISCTSNKNSEYREEYIKDTNGFDILMGQFAHNIENIWGLHEVLIAG PKDYVKYTDQYRTRSHINFEAGTITIETISPIDPTTYLRKAIITTLLMGDDPGSVDLYSD TNDIQISKEPFLYGQVMDNNGQPIRWEWRATHFADYLIANKLQKRQSGLHVIWSVTIQLV PNHLDKRAHKYLPLIRQASIKYGIDESLILAIMQIESSFNPYAVSRSDALGLMQVVQHTA GRDVFKMKGKSGQPSRSYLFDPENNIDAGTAYLSILQNSYLVDITNATSRRYAVITAYNG GAGSVLRVFSSDKKKAAQIINKMAPGDVYETLTTKHPSAESRRYLMKVNTAQKGYHH
n-region:MKK
h-region:LLALFVIAPI
c-region:LISC
Superfamily Assignment

PSA tool

>gi|37525170|ref|NP_928514.1| MRKKISSWIALIFAVLLLAACDGLEQKNIHGQTMGTYYSIKFVTGSSAPSPEALQKEIDR LLEEVNGQMSTYRPDSELSRFNQSRQIDRPFPVSPATAKVVKEAIYINKLTDGALDVTVG PLVNLWGFGPEGHVTKAPSASELEKRREWTGIDKLVVEGNNLIKTVPELYIDLSSIAKGY GVDVVAEYLESQNIKDYMVDIGGEVRTSGHNGKDLLWRIAIEKPSDTGMAQNAQEVIMPG NMSIATSGDYRNYFEQNGVRYSHTIDPKTGNPISHNLVSITVIAPVCMSADGLSTGLNVL GPEKGMEVAENLNIPVFMIIKTKNGFEERYSKAFEPYLQKNQ
n-region:MRKK
h-region:ISSWIALIFAVLL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37525234|ref|NP_928578.1| MMIRIKYLVAAATLSLALSGCAGNKNAVPDSPPAEIYSKGQEKLQKGSYPDAIKQLETLD NRYPFGPYSQQVQLDLIYAYYKSSDLPMALASIDRFIRLNPTHPNIDYVLYMRGLTSQAL DNSPLQSFFGIDHSDRDPEHARVAFKDFSQLVRYHPNSLYTADAIKRLMFIKERLAKYEL SVVEYYNKRGAYVAVVNRIEQMLRDYPDTQSTLEALPYMKSAYTHLGLIAQADKVAKLIA ANPV
n-region:MMIRIK
h-region:YLVAAATLSLA
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37525262|ref|NP_928606.1| MRQHWLILSMIAALLSGCTTPDKQKSAPLPAVPTQDVLGAEPRYEPYHPSANDDYQMNGH TYHIVQAPSQFSETGYASWYGEESSGKMTAIGERFNPYALTAAHPTLPIPSYVRVTNLSN GRMMIVRVNDRGPYKPGRIIDLSKASAERLNLTQSTKVKVDFIEVAQDGSASGPGTIGSQ IVKQSYALPGRPTLTTSPLGTPTMENIPDQTSSQPLTNQPMKLTIQPEATEQLPAMKLQP PKSVTNSTSIVTTPTAASANGFMVQVGAVSSEQRAKEWQQTLAQRFNVQGRVTQYSNVYR VQLGPFNNRQQAADLQQKLADQIQQSSFIVSP
n-region:MR
h-region:QHWLILSMIAAL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37525335|ref|NP_928679.1| MQLRKTLLVGLVASVLLAGCSTEQDTVTMSPLPQVENQFNPSEVWDKSVGDGVGRYYSHL TPTWQGSAVYVADRHGIVKALDIDSGKEIWSVNLAEKAGFLSSRIPALLSGGLTVAGDHL YVGTERAKVIALNTKDGQVAWQSDVAGEALSRPVVSDGLVLIHTSNGMLQALNESDGKVQ WSVNLDTPSLSLRGESAPAAAYGAAIVGGDNGRVNAVLISQGQLIWQQRISQVTSSTEIG RLNDVDTTPVISDGVIYAIAYNGNLVALDMRSGQILWKRDLGSVNEMVVYGDNIYIVDQN DRVMGLRQSDGVTLWTQTKLQHRNLTAPEMYNGYLVVGDSEGYLHWLNMDDGKFVAQHKV DSSGLMSRPVVASDKLMVQAKDGTVYLFTR
n-region:MQLRK
h-region:TLLVGLVASVL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37525376|ref|NP_928720.1| MKALTVILLILITNVSGCVSKKHAFSIDYKANGETFHLTPLCIEEIFPEKGDNYYSIFIK VKNNSHCSKPFNLFIKQNVGKKLSVFFNNKPILKNTNIITPMHVENGFYQAIDSNITFEE IVNSLN
n-region:MK
h-region:ALTVILLILITN
c-region:VSGC
Superfamily Assignment

PSA tool

>gi|37525389|ref|NP_928733.1| MYSPQAFRDNYFSGLHGLVHLASCSISPRSQFLDAAMETMLVDMAKNELAWVYFERQTEQ ARRLFAEFIGADASQIAILPNATIAAYQVISTLVANSGEQILCTEDEFPSLSHVWLQQAS RGLVTRCIESQVSDESFVTITCAMLGSNTCLVSVPLASFRTGRRYPVELITELANQSQVP ILVDAYQGLGAEKINVSELNCDYLICGSMKYMLGLPGIAFLYVKDGIRNTVALGLTGWQG RKEPFAFNPSLVDFPDCAKRFETGTPAVPALYAASSALTALLTLDFEQGRLHIQTLVELA IDILEKGDVTIVKVPGTLFSAHIALLVPNVPALDTHLKQHKIITSPRGEMLRLAFHHFNT ADEVVQTCRLICAYFKTQIW
n-region:MYSPQAFR
h-region:DNYFSGLHGLVH
c-region:LASC
Superfamily Assignment

PSA tool

>gi|37525408|ref|NP_928752.1| MQLNKVLKGLMLALPVMAVAACSSNKNADNDQTGVGTVNETNAGLSAEELARQQMQELQN NNIVYFGFDKYDINSDFTQLLDAHAAFLRSNPSYKVVVEGHADERGTPEYNIALGERRAN AVKMYLQGKGVSGEQISIVSYGKEKPAVLGHDEAAYAKNRRAVLAY
n-region:MQLNKVLK
h-region:GLMLALPVMA
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|37525439|ref|NP_928783.1| MTKRWFLTGTDTEVGKTVVSCALLQAATKAGYKTAGYKPVASGSEITPAGVRNADAVALL ANSSVSLQYEEVNPLVFVEATSPHIASDDSNQPIDFTVMSMGLHQLEKKADWVLVEGAGG WYTPLSESVTFADWVVKEQLPVILAVGVKLGCINHAILTVEAIIGSGLHFAGWIANEVEP AGKRQQEYLATLERMLPAPLLGTIPHLTQEYFNHLGEYIDLKLLNN
n-region:MTKR
h-region:WFLTGTDTEVGKT
c-region:VVSC
Superfamily Assignment

PSA tool

>gi|37525668|ref|NP_929012.1| MTLYKRIFIFFTILLTPIISCLADTKLDTLSIEDNKAISELLESIKTPNKPKVINLTIPS HEGGYRALLRYSGITEQKHPDVFKDIETIKAKQHALIKSGKSLEIHRSNKDPENFFGQPV IIPSKDYKSISATVFNSLYYPDPSLPSSFQDSLVVFALDKDKKSRQVIASGSSSIEGKEV RSHTTEAVSEEDILDGINNPNQSSVIAVATYQGKINGISLSDGPIIMKSNILYFDDVPKE MCNTSPNAPDYVKKKICNTDPGYKEYLQHMRPIIVCLNRSNPERGAPDACDYGPMTPEIP YSNTHINMEIIGSVEFDDYILIDENRKPKGTKRLPIGADLTLVGLDTGGGCKAREIDKNI FWEHVTVDESGKRLTWDFSKGSGYANFGSICWKNNERYVLDLQASILTTPDETDKQAYPI QFTYTNKGGSTPSDLQFIYPPINIQYGCIAEGTLIDMADGSKKKVEDIRSGDKVLTKQGG VLQVKSRIVGHDTEFVDLIYNNDEKVSLTPTHPVATLRGIVKADELKIGDTIYTRDGQTT LSSVKLRNTDPLNVYNFVLEKTDDKSELLLEDALLFAGGILVGDNNLQRKVSIAN
n-region:MTLYKR
h-region:IFIFFTILLTP
c-region:IISC
Superfamily Assignment

PSA tool

>gi|37525675|ref|NP_929019.1| MAIQFLTFYRWLLLPCVAAGLSGCAAIEKVDQQADTEMAQATEIIKGLRNSAAAMSVHVH EHGYWVSTKEIPSKKESETVSCRLTLEEAEPITLGEFADKIKRICGVPVVISADARLAVY PGSASGERGSERGVVVVNSGTPPVSGEGEPEVLKIHVNWHGSLVGLLDSVVSSSGLHWKV HNGAVHIFKTETRVFQIYALPGTDALSSSVTATTSATFGSGVSEGDSGNSGSTQTLATSL TRSVMDEIQKTVSAMLTPGEGKLTLSMATASLAVTDSPEVLDRIKDYIDQQNKLLTTQVV LNVKILNLTFDRADQYGVDWSLAYKSARIGLSNESGNSVIDDGGVSTNIHILKGPFSDST LLIKALSAQGKVSIVTQPSVTTLNLQAVPMQVATQTGYVASISNTSTPQVGTSVGIEPAT VTTGFNMLMLPYAMADKQILLQYNISLSDLKRLEKFGKEETGQVQLPTIDLRAFSQKVRL HSGETLVLSGFEQQSDTSDRSGLGSPDNQLLGGSRQGKRNHNVIVVMITPIVVD
n-region:MAIQFLTFYR
h-region:WLLLPCVAAG
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37525703|ref|NP_929047.1| MMRRLALILVIFISACSRQPEKTYYQLPVVAIASQKSAIVQHDRQLWVQRVMLSDYLSSS GVVYQSSDVSYVSAANHLWASPLEQQLQQVLVAELTMALPQRLVSAQPLVNKPDTLDVTV TSFHGRYDGKVILQGYWTLTHQGSVVKQPFNLELKQEEDGYDDLVRTLAKGWSQLVQAIA SQLISQS
n-region:MMRR
h-region:LALILVIF
c-region:ISAC
Superfamily Assignment

PSA tool

>gi|37525938|ref|NP_929282.1| MQGFDRKMNKVLSHKEELSHLTACLLSEVICSRTSFSWFKAIHRALKCPDRRFYFWWRIA NYLYRTNKAKKISIRINRNLRNKYGCDLGLGCYIRKNLRISHYVGIVISRTCIIGDNFHV LQNTTIGVLNEDIQGKISIGNDVKIGANSCIISDNITIGDNVYIGAMSFINKDIPADCIA YTPKSQNEIKIKKQKIIN
n-region:MQGFDRKMNK
h-region:VLSHKEELSH
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|37526005|ref|NP_929349.1| MRKFFLGAVLLLVGLISGCDQFKDISISEELINGYLAKHVHYQKQLELHGIANADIELTE LSSQIGRTEPNKIALTGRANVNVTSLLGPAKADMKLSLKAQPVFDQEKGAIFLKELEIVD YQITPEKMEKPINALVPYLNKSLSAFFDIHPIYVIKADHSKAEAAAKTLAKRLEVKPGKL VIMLTDK
n-region:MRK
h-region:FFLGAVLLLVGL
c-region:ISGC
Superfamily Assignment

PSA tool

>gi|37526063|ref|NP_929407.1| MTKQTGMKLFLLSMGPLMLSGCIRLEVATPEKPININMNVKIEHEIQIKVDRQVEEMLKN NTGLF
n-region:MTKQTGMK
h-region:LFLLSMGPLM
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37526142|ref|NP_929486.1| MTKFILTLSIILGLTGCVSQKQPLSLDYIAGNETFHLSKPCIEQALPVGEVGDDLAVNAN NIFIKVKKGLNCSDRFKLFLARNLGKELFIYFDGKPVIKTRLVSMIHPEEGFHQAVESKS LSDGILRSLN
n-region:MTK
h-region:FILTLSIILG
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|37526143|ref|NP_929487.1| MGDLITKKIRFAVVFFIALVVSGCSAFAENQTEDQNFNGNNNAQYVKIYLHNNTSHSLVA EKTDLLWGSWIEKPSSSISAYSHDSFASKGKIFSGTEGKIIYRLPNGEDKLNVHWNLSYW GVQNHNIHLSEASTHYKLEKTVKSSSSLGIQIDIYLTEKNIGSNYKIAVMSDPQPWRLDP EQGDPNADKKPWEELNKKVANSINNIYDRNHLAFGIVNGDLTEFGRASTRKSLEEIYTSK IKFPLFMGLGNHDYANNVNDCTYPEGFDFSRNACARSAVFDMAERISDYSKELNNFSYDY DNEAWKGSLSYSWDFGDIHYVQLQNYPTYNVNLDHYVSPTVYITKSLDWLESDLESAQTR GKAVVLNFHDGYDHFINNSSYAEKEKFKSLIKKYNVMAVFVGHSHFLKEYTASIFGNARV YDSGALFKGDFFIIDVNKKCMQISAYNGIDGTPKFVKKMTTVCGK
n-region:MGDLITKKIR
h-region:FAVVFFIALV
c-region:VSGC
Superfamily Assignment

PSA tool

>gi|37526165|ref|NP_929509.1| MRYPIYLHQADDGSFSGFVPDVIGCYFAGDTIDDAISGAQNALDTYFEYMSEKGEAPAQA GTVADHLSNEDCTGGSWAYVDMDLTKSGFFLLSIPK
n-region:MR
h-region:YPIYLHQADDGSFSGFVPD
c-region:VIGC
Superfamily Assignment

PSA tool

>gi|37526457|ref|NP_929801.1| MLNASNKKGFQTVLLGVLFSIAVLAGCSRQTGKTATQYQGIQYSQPENSQPAVALRDNAR AICSYVGGMPALAIQLNGAQIPVCQLANGKRCDERALLQGSCASS
n-region:MLNASNKK
h-region:GFQTVLLGVLFSIAV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37526490|ref|NP_929834.1| MFKHFLVSAVAVASLSGCVNTDSLSGDTYTAGQAKQVQTVSYGTVVSVRPINIQAGSNEN VLGAIGGAVLGGLVGNTIGGGSGNTLATAAGAIAGGVAGQNVQGALNTTKGVELEIRRDS GESIIVVQKQGKTAFHKGQRVRIAGQGSNITVSPRQ
n-region:MFK
h-region:HFLVSAVAVAS
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37526506|ref|NP_929850.1| MNRTKIVLGAVVLASTLLAGCSSTAKVDQLTSDIQTLNAKVDQLSNDVNAVHTDVQAAKD DAARANQRLDNQVRSYKK
n-region:MNRTK
h-region:IVLGAVVLASTL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37526544|ref|NP_929888.1| MIIRIKELLLLFSLLLIGCSSHAPRTPAPVLKTALSDPIMVIAQLKEQLNQWRGTPYHYG GMDRRGVDCSGFVYRTFSDRFDIQLPRTTGGQIKLGTRIDKSDLMPGDLVFFRTASGEHG LHVGIYDANNQFIHASTHKGVTRSSMNNVYWKKAFWQARRI
n-region:MIIRIK
h-region:ELLLLFSLL
c-region:LIGC
Superfamily Assignment

PSA tool

>gi|37526550|ref|NP_929894.1| MSFEQIKKVSVVIPIYNEEESLPLLLERTLAACKQLTQEYELILVDDGSSDKSAEILIQA AEQPENHIIAILLNRNYGQHSAIMAGFNQVNGDLIITLDADLQNPPEEIPRLVKTAEQGY DVVGTRRANRQDSLFRKTASKIINAMITKATGRSMGDYGCMLRAYRRHIVEAMLQCHERS TFIPILANTFARKTIEIDVAHAEREFGDSKYSFMKLINLMYDLLTCLTTAPLRLLSVVGS VIAVSGFLLAVLLMVLRLIFGAIWAAEGVFTLFALLFIFIGAQFVAMGLLGEYIGRIYND VRARPRYFIQKVVGDNKTNDNQEEY
n-region:MSFEQIKK
h-region:VSVVIPIYNEEESLPLLLERT
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37526562|ref|NP_929906.1| MKLKLSFVALVVLLVGCAERNVQQTNVGKQSGQQRMLSNTANAARISSSFSPTPFDTFIQ QASNRYGVDETLIRAIIQVESGFRPNAVSKSNAIGLMQIKASTAGRDVYRQKGRSGQPTT RELKDPKTNIDLGTAYISILKEQHLAGIDNPETLYYATIVAYVNGAGALLRTFNADRQLA VNKINRMTPDEFYQYVQDNHPAPQAPRYLWKVKKAYRSLVMVD
n-region:MKLK
h-region:LSFVALVVL
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37526635|ref|NP_929979.1| MAILLQKSKVMTVAGMSLVMLLAACSSDQSYKRQINDDETYLEAPPRKALKVPAGMVLPL QNGEYDIPAIASQGQVGKALDIRPPSQALALLSGSRTENSAKSSKLLLESTPENSHLWSQ INNVLLKKGFQVSQRDDASQTLTTDWIDWLRADENVPYQARHRISVARQSYQIELSVTNE GLRQGDHQITDPLEIQRYNTLMLNELIEGVNQQRERISDDSVARNLGSLDVQSGGDRSGL PQMIVRAPYNIVWDRLPAVLEKVGMKVGSRSRSTGSITVTYKSLSSSSWKSMGVNEPSIS EGDYKLQVGDLNNRSSLQFISDKGKPLTQSQNDELVAALKAAFSQTTGS
n-region:MAILLQKSK
h-region:VMTVAGMSLVML
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37526680|ref|NP_930024.1| MMKKIILVGLFMLLAGCSSLEDRGAYKVDSSFPSQGQNDRVRFLVFHYTAVDDKDSLRIL TQGGVSAHYLIPSLPNYVRGKPVILQLVPEEKRAWHAGVSGWNGRKDLNDTSIGIEIVNK GFTEMLLEKEWYPFNEQQIDLLTRLAKDIIQRYGIEPINVVGHSDIAPLRKYDPGKLFPW KNLAEQGIGAWPEDATVEKYMAGRKWHDKASVELIQKTLAKYGYTIPQTGVLDEDTRKTI SAFQMHFRPDDISGNPDAQTESIALALVEKYKK
n-region:MMKK
h-region:IILVGLFML
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37526714|ref|NP_930058.1| MRRILFVALSVMFLAGCPSLPPEQPEPPTPVVPVTPSEKPTPPSEKVPEPPKMSAIDWES TVQPLVEQLVKAHGLENAKLLLVDTVKNNTNGALQTMQATDALRQAISSEHVFELIPQNQ VQNARQSLGLSEEDSLGLRSKAIGLARYLNAEYVLYSIVSGNSDKRDIVMQLMLVKTGEI LWSGHGDVK
n-region:MRR
h-region:ILFVALSVMF
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37526776|ref|NP_930120.1| MKSLMLPVVLAIFLVGCGEKDLTIDASSSKALKSSTQEIYRSLDKDDAAKFKQAVLNVGL AASIVTNNEEDKIKAINKMIGGKTAKQIIEMDEKK
n-region:MK
h-region:SLMLPVVLAIF
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37526830|ref|NP_930174.1| MTKNTETLISACHELARVASCDDYLILNEIADKLKFLRKERDSYKEMFYDSCKGLAAIAN AAGIKAEDDSGSPGQVIEKIESMLNIDWNFSNQPKINIGEEKKYWAYVKKSVKKDYYLFN EETNKCELVCDPVKHHFYVTTLIYVNKPTPTGKHEYQWNDDLPDWAISDDEYDWINFVGW AIQYSHPDYCNWIDSLEKNEEVIAWAEFIHPSAPEISQ
n-region:MTK
h-region:NTETLISACHELAR
c-region:VASC
Superfamily Assignment

PSA tool

>gi|37526841|ref|NP_930185.1| MRLRCMAYRQDGMYVAACLDLSLAAQGDNIDEAVNKLEAQIEDYLSEVKSEPQYEKQMLS RKAPLSMWFKYWRIAFRIFMNRKDSGLAKVFNEQCEPA
n-region:MRLR
h-region:CMAYRQDGMY
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|37527065|ref|NP_930409.1| MMRKLILCSAMGSAMAFTLAGCKTELSTSVSVNQLLSEQVKTVTSDLLVEVSACGDYKDS RQSSKSLLDTQEKVPAIFANAEYVECFRKSMDSFAHFKVPVSVGNSSITGSTKGIHLYGN GADILVISVPKAIKEKINQIDSSMASKTKISINIKNDTGEVLKMTGLSAFLNDKEPMVIS NFSLKVGSEIKLTLSNVSVASALDERFDFTPVLMAISE
n-region:MMRK
h-region:LILCSAMGSAMAFT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527088|ref|NP_930432.1| MKYRLGGIALAAALLVGCANSSDTVEQERSDLLEGFNRTMFNFNYDVLDPYVLRPVAVAW RDYVPMPARNGLGNFLSNLEEPASMVNSFLRGNPYQGMKHFNRFFLNTILGMGGLIDVAT MANPKLAKEEPKRFGSTLGYHKVGYGPYVVLPGYGNFTLRDEGGNWADMTYPMLSYLTIW MSAGKWAFEGIETRARLLDSDGLLKNSSDPYLMMREAYFQSHDFMASGGKLKATENPNAE ALQGDLDSID
n-region:MKYR
h-region:LGGIALAAAL
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37527089|ref|NP_930433.1| MFKKLTLPLTAIFLSGCVHTTPMPVQISQPGDNLMSCESVIFEMEKMQNLVKQKDSELNG QIAKNSALGVTGVFLLIPLFFIDTSDAKTVEGKAAKDRYEKLQQIYRDKSCAEKEKK
n-region:MFKK
h-region:LTLPLTAIF
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37527106|ref|NP_930450.1| MLTIPFYKMVPVMATIALLLTGCGLTQTVTDGTAAATRSFFHKRVKTLHLDFIPRAAVNT DTGESVALSVPALVRVYQLRDNNAIKKVDYADLLDDGDRILGADCLASEEVVVKPGSHAS LDMPMAAQAKYVAVVGLFRNPDVAKGTWRRIIKRNELLPDSPRIIALNAGGLTLLPEKG
n-region:MLTIPFYK
h-region:MVPVMATIALL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|37527111|ref|NP_930455.1| MKKQQLRLAVLCLLLVACSQFPAQAGIIIAINHTKWAINRFTVDDQPGIDSIGPYQGGGG GCCYRAPDKWRPGMTVKVDWETGVAFSDDFPGYENDEKYLAWRDKINAQKRQHSQVVPLP DYTGQRTCGITVHFLPCDQVKITTSCNTYGSPNYPIKEPLEMKEPKVCPK
n-region:MKKQQLR
h-region:LAVLCLL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|37527112|ref|NP_930456.1| MKKQQLRLAVLCLLLAACSQFSAQAGIIEAINHTKWAINRFSVDGEPGIDIIGPYQGGGG GCCYRAPEKWRPGMTVKVDWETGVAFSDDFPGYENREKYLEWDRKIRAQKRQHSQVVPVP DYTGQRTCGITVHFLPCDQVKVTTSCNTYGSPNYPIKEPLEMKGPKVCPK
n-region:MKKQQLR
h-region:LAVLCLL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37527125|ref|NP_930469.1| MKKQQLRLAVLSLLLVACSQFPAQAGIIIAINHTKWAINRFTVDDQPGIDIIGPYQGGGG GCCYRAPDKWRPGMTVKVDWETGVGDMGGFPGFADRKKYLAWRDKINAQKRQHSQVVPLP DYTGQRTCGITVHFLPCDQVKVTTSCNTYGSPNYPIKEPLEMKEPKICPK
n-region:MKKQQLR
h-region:LAVLSLL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|37527126|ref|NP_930470.1| MKKQQLRLAVLCLLLVACSQFSAQAGIIEAINHTKWAINRFSVDGEPGIDIIGPYQGGGG GCCYRAPEKWRPGMTVKVDWETGEASTKGFPGFADEEKYLSWRNKLRANDRQHSKVVPVP DYTGQRTCGITVHFLPCDQVKITTSCNTYGSPNYPIKEPLEMKEPKVCPK
n-region:MKKQQLR
h-region:LAVLCLL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|37527127|ref|NP_930471.1| MKKQQLRLAVLFLLLVACSQFPAQAGIIIAINRTKWAINRFTVDDQPGIDSIGPYQGGGG GCCYRAPDKWRPGMTVKVDWETGVAFSDDFPGYENDEKYLAWRDKINAQKRQHSQVVPVP YYQNGGDTCGITVHFLPCDQIKVTTSCYAYGSPNYPIKEPLEMKEPKVCPK
n-region:MKKQQLR
h-region:LAVLFLL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|37527190|ref|NP_930534.1| MLLPRVSVGGFSMMLLIFVVFLLAGCVKNPVNNNLATVTQMVIPEQRVTDYRIAECGLMW DLETPPSIENALYWLRLMDCSDRLTSARARNMAKYTLPVTWDMAFKQSILLNSAGPTLSE RRKMIENFNKYRLKFPNPLRALLQLWREQQVQQIAVAEERAKFQKLQADTDNKLDRLRES RARLEFELQQTSRKLENLTDIERQLSSRKQNQGSAGSGNSDKHVETPETTALPNKNSTPN STSESDKGAAP
n-region:MLLPR
h-region:VSVGGFSMMLLIFVVFL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527367|ref|NP_930711.1| MTPINRLYLSGDEIHLVDANIMLELASCGRGFITAETTTDYTGKLVRLDVGYTDLVLRWF TGYVARSQPAQNGYQRLFVRELVGVFDRLWSCSFQHPTLSQIVDWLQEHSGLTFILPDAP YTETPIPHFTHHGTGYQLLANLGQVFSIEDYLWHQLPEGSVYVGSGAHSMFAGKPVEIPN AFSQCQSAGNAMTIPMIPSLRPGVVINQYRLNKVNLNNENMVITWEAVNKLTGQSQTKTP MQRQIDAAYPELSAGLHLPKFARIEAHPENTVSGDISDSFRPRYAVDVQLLADDGQDAAV PVYHAVPLPLPMAGSESGMFQYPPVGTVVEIAFEAGRPDKPFIRQTLSQGNTLPDIKPGE QLQQQRAEVSQRVTQEGNWIRQTDQTINESSMHREVRADTETRNVVARETTIQATDKTTV LGTSTLLAGAVRQIADGDYSMATSSNFVASVGKEASIEIGQKLIEKIGLLKQSIAGARQE IIAPVVWVGSQQINVMTLI
n-region:MTPINR
h-region:LYLSGDEIHLVDANIMLE
c-region:LASC
Superfamily Assignment

PSA tool

>gi|37527493|ref|NP_930837.1| MNFIRKIAVIPLFTLFTLLAGCTSWEKPGATQYERDRDYAECKALGYSQLPSDWTSEVVH SFETKHFSCKDKDKDEDKSCNHYITVPKTEVKRWDKNESSRRWIISSCMYKKGWHEETRY WF
n-region:MNFIRK
h-region:IAVIPLFTLFTL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527599|ref|NP_930943.1| MKKLLVICLLGCVLAGCDSQPKMDASNEIALKASIEKVRDRLPDDKKVKFDESIQSAMFN SIDFNDLVKSGSNGDMEKSKQKFYKLLDGKTADQLITEVEKIESKRSKNE
n-region:MKK
h-region:LLVICLLGCV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527647|ref|NP_930991.1| MKKHYIICVMLAVLMLTGCKIELYTDVSQKEGNEMLALLREAGISSDKQPDKDGNIKLLV EESDVAQAVEVLKRKGYPRENFSSLQDVFPKDGLISSPIEERARLNFAKAQEIARTLSEI DGVLVARVHVVLPEEQDRLGKKLSPASSSVFIKHAADVQLDTYIPQIKQLVNNSIEGLSY DRISVVLVPAAGVRQVPLAPRYSTLFSIQVTEESQGRLIGLLVLLLALLFISNLAQFLWH RSRIQ
n-region:MKK
h-region:HYIICVMLAVLM
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|37527711|ref|NP_931056.1| MRINRGVLPLATVLVLSGSLALSGCNDKDSQQVAGNQQAPEVGIVTLKTEPLMVTTELPG RTSAFRIAEVRPQVSGIILKRNYKEGSDVKAGASLYQIDPATYQAAYDSAKADLAKAQAH AEITRLTANRYKSLLGTNYVSQQEFDKASADYAQADAIVQAAKAVVETNRINLAYTKVTA PISGRSGKSTITEGALVSVGQPTALTTVQQLDPIYVDVTQSSDDYLRLKNEIAKGIVQKE DNKAKVHLIMENGKNYSETGYLEFSDITVDETTGSITIRAIFPNPNEELLPGMFVRAKLE EGIRQDSILVPQQGVTRTPRGEATVMVVGADEKVEPRVITTNQAIGDKWLVASGLKAGDR VIVTGLQKIKPGIPVKAEEVDLNAKPAANQAEPAKKS
n-region:MRINR
h-region:GVLPLATVLVLSGSLA
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37527714|ref|NP_931059.1| MKLWQLPAGVLLAVALVGCNVKGAEVADTQVEQIENLMKRSFVEGNINILQRIALPADAV LTVALSDVSLADAPSVTLSQKVERLGGKQSPFHFVLPYQPNKIKPNARIVVRASVSLHSR LMFVTDTAYEVINNGKTKDVEITLKAVR
n-region:MK
h-region:LWQLPAGVLLAVA
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37527732|ref|NP_931077.1| MLKRILFPFITLFLLAGCAAPSNILTIEPKITLPTADPTMGAITISISGADNRQSQTLAQ VNRNAKLEILKPSRDLRFLLQEILEKQMAARGYMIGSPANANLQIIVNNLYADVKEGSLR HNISTKADISIISTAQNGSKQVKNYRTSYNVQGPLGATNEKIADAVNTVLSEVIADMAQD PSVSNFIKQNAR
n-region:MLKR
h-region:ILFPFITLFL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527735|ref|NP_931080.1| MRLMKYNKGIGILSILAATLVLSGCDMVLMNPKGAIGAEQKTLILTAIGLMLIIVIPVII MAFTFALRYREANRSATYRPNWAHSNKIELVVWTVPIIIIIILATITWKTTHELDPYKPL VSDEKPVTIEVISLDWKWLFVYPEQGIATVNEIAFPSGVPINFKITSDSVMNSFFIPQLG GQIYAMAGMQTKLHLIADEPGTYKGLSSSYSGHGFSGMKFTATATADREGFEQWVQKVKA SPKTLDTMQAFNELAKQSQNHPVEYFSSVKPNLYQDIIAKFMGNMNMHGGHGTTTGHNMN MSETAHAGVEE
n-region:MRLMKYNK
h-region:GIGILSILAATLV
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|37527820|ref|NP_931165.1| MNRILVALSLLAAFVLTGCSKSVPYDYTAFKESKPKSILVLPAVNKSLEVKAGHSLISHV TYPLAESGYYVFPVAVVEETFQQNGVTAAQDVQDISYKKLHDIFGADSALYLDIEEYGTQ YQIINSDTRVTASAKLVDLRSGKQLWHGRAMVSSTENQSNSNNLVGMLVSAVVSQIANTI MDKGHEIAGITSNRLLTAGGSRSLLYGPRSEHYGKENQKH
n-region:MNR
h-region:ILVALSLLAAFV
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|37527821|ref|NP_931166.1| MILMKKAGLLLAAMTLAGCVTQPKTIYEWDKYQPTIYQYYQQDKMGFEEQLQALQQVIER AKAKDKSVPPGLHAQIGLLYSKTGRVSEAFHQFEIEKKLFPESAPFMDFLLSKNKGTMQ
n-region:MILMKK
h-region:AGLLLAAMT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527822|ref|NP_931167.1| MQGKLILSSICLASAILAGCTTESSNTVQVQKVNSYNTVYQGVRSPIAIGKFENRSSYQN GIFSDGVDRLGNQSKTILISHLQQTGRFTVLERTNMAELKAEAGLQGKSQKLKGAAYVIT GDVTEFGRKEVGDHQLWGLLGRGKSQVAYSKVMLNVVNVETSEVVFSVAGAGEYKLSNRE IIGFGGTASYDSTLNGKVLDLAIREAVNRLVESVETGAWKPSN
n-region:MQGK
h-region:LILSSICLASAI
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527900|ref|NP_931245.1| MTPINRLYLSGDEIHLVDANIMLELASCGRGFITAETTTDYTGKLVRLDVGYTDLVLRWF TGYVARSQPAQNGYQRLFVRELVGVFDRLWSCSFQHPTLSQIADWLQEHSGLTFILPDAP YTETPIPHFTHHGTGYQLLANLGQVFSIEDYLWHQLPEGSVYVGSGAHSMFAGKPVEIPN AFSQCQSAGNAMTIPMIPSLRPGVVINQYRLNKVNLNNENMVITWEAVNKLTGQSQTKTP MQRQIDAAYPELSAGLHLPKFARIEAHPENTVSGDISDSFRPRYAVDVQLLADDGQDAAV PVYHAVPLPLPMAGSESGMFQYPPVGTVVEIAFEAGRPDKPFIRQTLSQGNTLPDIKPGE QLQQQRAEVSQRVTQEGNWIRQTDQTINESSMHREVRADTETRNVVARETTIQATDKTTV LGTSTLLAGAVRQIADGDYSMATSSNFVASVGKEASIEIGQKLIEKMGLLKQSIAGARQE IIAPVVWVGSQQINVMTLMLETLDVVKALAEQTAAHTHHNTGAPENASAIRNTGYKSDGL KQKYSPVIG
n-region:MTPINR
h-region:LYLSGDEIHLVDANIMLE
c-region:LASC
Superfamily Assignment

PSA tool

>gi|37527945|ref|NP_931290.1| MKIIAGKTLLAGCIAMMMSHSLWAQEIKVAIVGAMSGPVAQYGDMEFTGARQAIADINAH GGINGNKLVGVEYDDACDPKQAVAVANKVINDNIRYVIGHLCSSSTQPASDIYEDEGVIM ITPAATNANLTTRGYQMILRTTGLDSDQGPTAAKYIAEKIKPQHIAIVHDKQQYGEGLAR SVLDKLKKAGANIVLFEGVTAGDKDFSALVARLKKENVDFVYFGGYYPEMGQILRQAKQA GLNIRFMGPEGVGNSSLSNIAGVASEGMLVTLPKRYDQVPVNKAIVEAIKGKKGDPTGPF VWTTYAALQSLAAAMNRTGSMEPTDLVQDLKANPVDTVMGRLSWNAVGDLKGFEFGIFEW HADGSSTSVK
n-region:MK
h-region:IIAGKTL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37527977|ref|NP_931322.1| MRIKVLLSASVLLLLAGCTTTNQLTSGGSQVRFVDTKPGSECQLLGEVTGTQSNWMTGVS NESSSMRGAANDLRNKAAVMGGNVIYGVTSPSESLLSSFAPLDSKMIGQVYKCQ
n-region:MRIK
h-region:VLLSASVLLL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37528038|ref|NP_931383.1| MAAINVKSVMMGGIVCLMLQGLVGCGLTQTVTDGTVAVTQSIFHKQVKTLRLDFSARSAL NTTDAQTPLSTVVRVYQLKDNKAFKRASYADLLKGDSEALKADRLTQRDIRVAPKGSVSL DMPMEKAARFVGVVGLFHTPDATNNSWRLVIRRDELDADKPRTIELGSGTLTLNAVKE
n-region:MAAINVK
h-region:SVMMGGIVCLMLQG
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|37528122|ref|NP_931467.1| MKKQEKTTSRAIIAASMLTLITGCSHMEKIHMPEKNKPVLSTKLNIHQPTSIIVPVTISG KKYQFLLDTGASYTFIDNKLAKTLTQTTPESKIPVTFHRMLSDGLVTTSEKRLHKADLTL WQPLAITLGNHTVPSSDPWIGIDMSLFNQSIGQELDGILGIDTFRQLNWEINNLNHTLTV WRHAPSILNYQQCEPYSDSYGKSPAIQVSNVVFNIDTGADYSYVAQEFIEYLKKEHKDKI SEGTSVKYASASGLDSSKEYLIDGFYLQQLPVGRLRIGENKSGLYNLGMSFFSRFDNYLF IPNKMLLCFNAKNFTRYDSPLLRTIAIRYFNNKVEIFYNDPKDIEKFGLKNGDIVLEVNG QQALPKDITYLRNQLSETPSGKLTIKIERDNTQKIITI
n-region:MKKQEKTTSR
h-region:AIIAASMLTL
c-region:ITGC
Superfamily Assignment

PSA tool

>gi|37528299|ref|NP_931644.1| MNKQFFKIFSISAMMLALAACSSSNKIYSAKFLQPKKQPLKWEVFEGNARTKKLASQLVD QYAQDIFNSSNAQGMAMVVIDNNQTVYRSFGETRPGNGIRPKPDSIIRIASLTKLMTSEI MIKLEEDEVLRSTDPLQDYSYYGVKVPQYSPLQPIRLFHLASHTSGLPREQPGGRWGRPV FVWPTQANRWTWLKTAQLDSAPGTTASYSNLAYDLLADALSKATGKPYTRLLYDKITGPY CMKDTTLTPNRSQCARLMESYKPSPCLNTVAAAGSGGIYSTPKDMQHWMQQFLSSDSQLR KQTASREQGIYFKRSALASIKGMDVAGQADGVGLGWVYMNARGDVPGIYQKTGGGGGFNT YMAMIPEQNIGVFVVITRKQHSLFSSVTTGVNQLVTALSKNHHQA
n-region:MNKQFFK
h-region:IFSISAMMLA
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|37528343|ref|NP_931688.1| MNLFLRWCYAVAILLLAGCSSKDWRKNEVFAIPLQPSLQQEVILARMEQILASRSLTEDE YAQLLYERGVLYDSLGLRALARNDFSVALSIRPNIPEIFNYLGIYFTQASNFDAAYEAFD SVLELDPTYNYARLNRGIALYYGGRYKLAQDDLQAFYQDDPNDPFRSLWLYLVEKEFYPK GAMLNLSQHYEKANRGQWGWNIVEFYLGKISEYTLMNRLKENATDNTSLAEHLSETDFYL GKHYLSLGDKDSASALFKLTVANNAHNFVEHRYALLELALLGQEQDDLSESDQQ
n-region:MNLFLR
h-region:WCYAVAILL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37528440|ref|NP_931785.1| MKLKRCKGFAVPLMLLVSLLAGCDKPASTNNAPSDKPGYPKEITTALGTAVIPHQPQRVV ALGAGAEDIVLDLGIVPVGIESHRWGGDEQGYLPWFKQAIQQRGETLPTVIEMYPELDIE KVISLKPDLIVATQSGLTQEIYDHLSYFAPVIAYPSAPWLTTPQQQIELIARALDKQPQG EQLATELNVILRESGNTIPHISGYTFAYIKAGISSNMLSVYVRGDPRVDTLIHLGLTLLP SVSTLADPFGSFAANIGLENADYLNGADILVTWFNNEQERKAVEAQPLFQSIRAVHLGGY IPLTDQSLVVAMSYGTPLSLRWGLSQFMPVLAEAIKSS
n-region:MKLKRCK
h-region:GFAVPLMLLVSL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|37528458|ref|NP_931803.1| MKKKLRGFLAIITLFVLSGCGLKGPLYFPPEQPSTEKATTASQIPANTEQQGQQVDSTSQ K
n-region:MKKKLR
h-region:GFLAIITLFV
c-region:LSGC


References

  • Madan Babu, M. and Sankaran, K. (2002) DOLOP - database of bacterial lipoproteins, Bioinformatics. 18:641-643. PDF
  • Madan Babu, M., Leena Priya, M., Tamil Selvan, A., Madera, M., Gough, J. and Sankaran, K. (2003) An updated version of DOLOP with functional assignments to predicted lipoproteins, Journal of Bacteriology, in press.

 

This website is Maintained by M. Madan Babu * and K. Sankaran #
* MRC-Laboratory of Molecular Biology, Cambridge - CB22QH, U.K
# Centre for Biotechnology, Anna University, Chennai - 600025, India

This site is dedicated to Prof. Henry. C. Wu
Last modified : 14th April 2005