63 predicted lipoproteins out of 5683 predicted ORFs for Nocardia farcinica IFM 10152


Functional assignment
Protein sequence
Signal peptide features
Superfamily Assignment

PSA tool

>gi|54022129|ref|YP_116371.1| MRIRAATRIAAPVLALGMVLAACGGDSGQLTGENTIGASSDINPREPGELRDGGNLRLAL TSFPATFNTHHVDSDGGVSQVLAATLPGTLESDAAGELTVDHDYFTDVQLTGTNPQQITY TINPAAVWSDGTPITWEDLRAQATALSGRDTAYQVAATQGYSRIEKVERGVDDRQAIVTM AQHYAEWQGLFNPLYPKATNETPEAFENLDREAPRVSGGPFMVTEIDRAQQRIVLSRNPR WWGETPKLETITYSVLDYTARLNALQNNELDSADVSGLDEVQAASQTPGLVVRRAPALRF SHMTFNGAPGSILEDPRLRVAISKAIDRQAIASALLNGLVADPKPLNNHLYLEGQKGYQD NAQAVAYDPEQAAAELDALGWKLNGDVREKDGRPLEIRNVMYQQQNWVQIAQIAQQNLAQ VGVRLKIETYPGNGLFTDVIDPGNFDIANFVWMKSIFPLGALPQIYAYDPANPLSNKGRI GSPELNDLIERTISELDPDKAIEMANEADRMIFELGFSLPLYQSAGIVAQREDLANWGAF GLQSADYTKVGFLK
n-region:MRIRAATR
h-region:IAAPVLALGMV
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54022130|ref|YP_116372.1| MRIRSATARLVIGLLVCGLVGCSAADRSADGLSDALGTSSDINPVPREQVREGGNLRLSV SAFPANWNTLSIDGNEGDIADIERPMMPRAFRIDAAGKLTVDTDFFTDVALTNTNPQQVT YTINPKAVWSDGTPVTWADIAAQAAALSGRDTRYQIAMTNGFDRVARVDRGVDDRQAVLT FERPYAEWRGQFAGNAALFPKSVTGDPDSFNSALVDAMGPTAGPFRVQSTDRAQGRIVLE RNPLWWGTPPKLDTITFSVLDSAARVAALQNDELDVTPLTSIDEVLTVRESAGLEVRRAA GSRFRHLTFNGAPGSILADAGVRVAISKAIDRQAIASALQNGLVEDPKPLNNHIFLQGQE GYRDNSLPFDPAAAERELDALGWRREGDVRVKDGRRLVIRDVMYDDRTWVQIAQIIQRNL ADIGVGMQIDTRPGAGFFTDVIQPGDFDAAQFIFQGDAFPLSSIPQVYGYYPDDLQGNFG RIGSPELNELIERTLSELDPQRAIELANQVDRAVFEEGHSLPLFQWDGSYGVRADLANFG SPGLASYDYTAIGFVQ
n-region:MRIRSATAR
h-region:LVIGLLVCG
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|54022149|ref|YP_116391.1| MHRIRGKVAGLALAIAATGLLAACGDDDSTASSTPTLTTGATATSAAAASSSPAEGAPQS QAPAPEAPPSETVAPERPQPVPTEAVPPADTSGLSEKDKAFIAALEEKGVTPSSPDIALS IGSYVCQSVQAGASEQDLTTFVNAMAGADASFDPAKMPVEQAGRIYIDTAKQTYCQ
n-region:MHRIRGK
h-region:VAGLALAIAATGL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54022508|ref|YP_116750.1| MRRARRTATVLALGVSLTLGLTACEWDGLNSLPMPGAEGTGEGAYQIRIQMPNVTTLTAN SPVRVDDVDVGSVTDIEVQDWHALVTVSLNRDVRLPANAIAKIGQTSLLGSNHVELSPPT DVVPEGQLRPGDVIPLDRAGAYPTTEEVLSSLSVVLNGGGIAQLETITKELNAALTGRED AIRDLLPQLNELTTNLRDQTGDIIAAMEGLDRFGGQLAQQRTVLETALDGIHPALTVLAD RRENITRAITALGELSDVTQRVIDTSGENLKANLASLGPVLQQLADTGNNLTESLKILLT FPFPMKNLDNAIKGDYLNLFMTVDMTGKRLDTNWLTGTPLGGRFGGVEGIVGSFAPTTAS DTGNPATGPIAGPTPTPSPTPTIPGLPPIPGLPAIPGLTVPLEGGQGR
n-region:MRRARR
h-region:TATVLALGVSLTLG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54022567|ref|YP_116809.1| MNFKRSSALVGALAVVAMPLAACGSDDNTSGDTSNAANSSVACGGKESLKASGASSQKNA MERFIAAYEANCDGYTLNYTSSGSGAGVNEFLGGQTDFGGSDSPLSQSKGEPAKAQERCG APAWNLPTVFGPIAITYNIDGVTDLVLDGPTAAKIFNGTIKTWDAPEIKALNPNAQLPAA PIAVIFRSDESGTTDNFQLYLDAASGGAWGKGGGKTFNGGVGEGAKGNEGTSAAIKNTKN SITYNEWSFAKSQNLSVAQIVTSAGPEPVKLSVETAGKAIDGVKIKGEGNDLVLDTSSFY QPTVAGSYPIMMATYEIVCSKYADAATGQAVKAFLTSAVTNGQNGLEDNGYIPIPEQFKT RLTTAINAIS
n-region:MNFKR
h-region:SSALVGALAVVAMP
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54022715|ref|YP_116957.1| MSRTRDRFGRLTAGLGAAAVVSCAVVAGAPHAAATVDELTVNSRNPQAGCVYQLTAKVNH WFEVWFYDNALVIAGSPVKPVNGVATIQWKPGRSGTHTLAALQGLAYEIKVDVGEPTLTG SATCGAGPLGWMGS
n-region:MSRTRDRFGR
h-region:LTAGLGAAA
c-region:VVSC
Superfamily Assignment

PSA tool

>gi|54022823|ref|YP_117065.1| MNRMRIRTLLCVAAAALTGLTACTSDPDHAASRYDLAQVDSGNYPTVPRDAETARTEYTG AMLEAARLGAALPLAADIDGKFAFRPTVYVDRRITPVKVPPDVSTFADLAEFTELTEGLV AGWNTRGQRRERPGLGSALEMFALRFESQAAAQTAGRRLAERLHSRTPGDPVAVPGLGDA TATWSVSNRQLNAQLAREGMLLLVRVEDPVTEPPDSAPQAALAGRAFTEMLNGLNRYTPT PVDQFATLPVDAEQMLRRTLPLEDATQFTRATDPSMVLTRQAWLHSSHFPTRAKAAYADA GVDLVAVSGATLYRTADAAAAERLVAALADEDSAHYAPMDSPPHMPGVRCHDRKDPKDSA TRYPPVCYLGYDRFVAVLTGDNQQHVYQQTAAQYKILAAS
n-region:MNRMRIR
h-region:TLLCVAAAALTG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54022825|ref|YP_117067.1| MRSAKAILLALGCAVALTACGSAVTGTPVRVTTDPSTVDAGNYRVEPQVLGNAKNDKQAR SVEALRLADYVALPFEADPSYVQDAWFVNPHIVLNRKALGSLVINDTFDDVAEDLVAGWV NSWSTGGPPEAPRRTLSIAVLMFPDAATAQRVGPALEHDDFTYNIDNQPVPITKYPATTA HWRPGVSSLGSWTVHDRYVVFVKVDDNLVPPDLPNLVGHVERILDVQIPLLDEFEPTPPD QLAKIPLDPTGLLGRTLPSDANRPPRAEPDGVYTRRGAVTLMDGGAELLAELDRAEVDLM SFGDAVVFRSKTAAGATQLWRDWQFSTHLDPDQTLVDAPDGLGDHVECLLDSPSAESSTL DMNICMFQVDRYVVQAYGRNLRDLHQKMAAQYVLLTAK
n-region:MRSAK
h-region:AILLALGCAVA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54022827|ref|YP_117069.1| MPGRHWVRRVAGFVVVVAAVAGCGQTVPGLPQAGMAPVELTALNLGPYPGEPVDYESEVS TKMDVFRIEARRMLGFLVSPDEVDPEMDHLDELRVVESLDSLFGEPPLGIYPAAFKPVMD RNFLLAGVTTTRSNNTPRTIRNTLHSLLRFPSDAAARTAAAELATTMAELVPGGRRVPVP GHSGLEFLTADDKKGFLFAARGPFTLLSMVTLPAPDPAGLGDRISKLVTLQFDRIDKTPV VPVDEILDLPADPDGIMRRTLPPGDGEYSDLPRQFVGALSPAARLHFERDAAALRPVFER AGVDLVGQYSGVVYRTADLQSAFLLQTALARLGRYDEEIDPPPGLTDARCWKIDDRDPVR SSTYKCALVRGRYVAVVESARMTFDAGLYQRAAAQYSILAKSE
n-region:MPGRHWVRR
h-region:VAGFVVVVAA
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54022828|ref|YP_117070.1| MVRTSRIATIVAWVAAAATLAGCGAVSGTALPAEPDVRRLEVGTYPVTRHSYDQNSAGKG ALLEGMRMSEAVVPTVTIDPSLKFGRGSTVLTDSEHALDFLAKVSKPVLDNRKLVTGFAA SGADEPDPAGETRPAPDTTAVTDVVLRFPDEATAKLAARELEDADIGVSPENQRLGSTKY PDAYIHWRPGIANVGAFIAHRQFVVSLFIQRPRADSTDLVKWIDKTLDAQLPALDRFQPT PVDRLDTLKVDPDGLLARVVVAERTDREPDPADFAIYGPNHAVHVSDDESATLRLVEQTG ADKIAVVDAGSVTRVRDAEAAPRLIDGMIDTAGEQFDPIDAPKDVPGAKCLQLNDRGDLE REYKYRCYVPYKRYVGIVTSDKEPDVRQKVAAQYALFANSL
n-region:MVRTSR
h-region:IATIVAWVAAAAT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54022830|ref|YP_117072.1| MAKLRARVFLTVAVCAIALLTGCTREVDGRAVSVYDDPFKVAGLPTTSGPSGPRSGVPDS TLTAIDGDGGEIDTLALNAIDDIQSYWRTEYPRAFGGEFTPVERLVSWSAKESRADAAEF CKESTYRLVNAAYCRLDTSIGWDRAVLLPTMAETFGQMAVVMVLAHEYGHAIQDQAEIVD PKDPVIVKEQQADCFAGAFIRHVAEGKSAHFTINTSDGLNSVLAATVAIRDSDPDDPESV HGSAFERVTAVQIGFTDGPQACKNIDIDEINQRRGNLPQTLGGTDGEYPIDKESLIELSK ALAAILPVPDSPTYVYSGAGIDCRDGVTTAPVSYCPSDNTIATDIPLLAERGTADVDETD PLPLKVTGDYNGYVVFIARYTLAVQYSHGQSLTGAKTGLRAACLAGVVTGKLADPNRQRS QGNISLAAGDLDEAVSGLLTDGLAASDVQGKTVPSGFSRVDAFRAGVLYGENTCMSRYS
n-region:MAKLRAR
h-region:VFLTVAVCAIAL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54023116|ref|YP_117358.1| MSRRRAFLRIAFAIAPVVALVAACGSEPDAGSDSGTFVLKVTDPGNSGPLAVGKRDGLFD AALAPLGAKVEWVNTTPGFSSNLKLFNTGELDVSGAAFSPVVGALSKDVGVRIVAVQDPA GKDQSGIIATPQSGIRSVQDLVGKRVAVNPAAKGEYILLRALAQAGVPADQVTRVPLQQK EAASAFATGKVDAWASFLVPYQEAKANGGVEIATEASIGSRDNTVVVFRTEVLDERPDIA AKYLEVLQQLSERQRANPAEFENVFEQTGPRALSGQRLADALRVGGEATVPHLPDQEDAE ALADVVDIFLANGVISRAITPADIFYDLRAKLTRDQLAAVRAGS
n-region:MSRRRAFLR
h-region:IAFAIAPVVAL
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|54023379|ref|YP_117621.1| MTTVSQRTQRPPNLARRTLLIACGATFIALLDLSVVNIAFPSLARDYPDTPVTTLTWVVS GYGVAFAALLTPAGRFADALGRRRLFLIALAAFALTSLLCGLAPDAATLIAGRVAQGAAA ALMMPAALGLILAVTPRERIGAAIGAWSAAGSFAAVVGPPLGGALVEAFGWRAVFVVNVP IALALMLPARGLPETGLRPPGSGLPDPVGTIAVALGLGGLVVGVTEGQRWGWTAPTTLLA LGVGAALVAVAIARSARLTVTGRAAGAALAVGLWRSRPYALANAASFVFAGAMYSWLMAG PLFLDAVWGYSVLGSAGAMTAGALTSMITATAAGRITAPAVRRWAGVLGALLFAAAALWM SSDSFGPDPALWTAWIPAGVLGGGGIGLVLTALGTAAAAALPPEQFAAGIGMNLTARQVG GALGVAVMAAVLAAHPGDALTGLHTHFAVCAAIAALTAVLTALPSRQEQP
n-region:MTTVSQRTQR
h-region:PPNLARRTL
c-region:LIAC
Superfamily Assignment

PSA tool

>gi|54023390|ref|YP_117632.1| MRMHRSTAGLVVLLGSIAVASCGSETGPGSSPDAEGSGVTERQICEYAAAQFRDVWGEKR ELELLPLQFGSASDRVLGAGGIGVVCQFETGDDLYATLAVRPAKGPVDRGEREVTVAGTP VQVSWSNLIRPHFETVLGDWQGALDIRPANSDETFVSPTDAQAQAGAKVLVTVLERAAS
n-region:MRMHR
h-region:STAGLVVLLGSIA
c-region:VASC
Superfamily Assignment

PSA tool

>gi|54023606|ref|YP_117848.1| MRIAVVLRAIVAAVGVVGVVGCGTTVDGTPTESAAKPSDAQFNPCTDISDDVLRGTGVDP ASKDVVTDAAGPSAWRICSWDAIDLPYYLVVASSINTVADVRNNDKETGFREVAIGPRTG LVHQDKSDTKGTDCRVAIPAEQGMFVISASWRTSETITRDRCELAIGHARDLEPHLPD
n-region:MRIAVVLR
h-region:AIVAAVGVVG
c-region:VVGC
Superfamily Assignment

PSA tool

>gi|54023612|ref|YP_117854.1| MTRTSAALAVSTTLFALLIAGCGDNADDAGAPGTSSSPAASAPAGSVPDTAKAGMFVVSY RSAFPKLAEGRSDAQIAELFTGTCSDITGGKSEDAVVDGIVERTGSGGTAATTEEARAIY TTAKYMC
n-region:MTR
h-region:TSAALAVSTTLFALL
c-region:IAGC
Superfamily Assignment

PSA tool

>gi|54023617|ref|YP_117859.1| MPHSRWISRSPMLVAAAFAVAALSACGTSGDPNPAGSSGPTTSSAPTTQAPTTQRPEPQV SAAAAQKLCDAIRPELSNFRVQGPTLGRVGLNLIVHPWGLQNGIDVLNNKTVVDTATSKS CPDVRQQAIEALEVPDLATVVVGL
n-region:MPHSRWISR
h-region:SPMLVAAAFAVAA
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54023758|ref|YP_118000.1| MGRVRIGVAALAVAGALLVTACGSDTEDAAAPPPAAPLGTVVPAAPATGEPFTSPDALAL RLLADTELPAGMTAAYDPSTDAPGQQAGVPAPTTPPGCGKVLMELGHQRPEALAWTAVAY NGPDFASIDIDAASYRPEAVGPAFTAVQETLRGCTEYFGEDADDARIDYRLGALAQPPAG DAATAFELRMTSEGLTLVAHVALVQVGTTLAQISVTAPESSDPALLAELTAAQVRKLRGV TEP
n-region:MGRVR
h-region:IGVAALAVAGALL
c-region:VTAC
Superfamily Assignment

PSA tool

>gi|54023790|ref|YP_118032.1| MNRPVRILAAAALAATLAACGTAHPTASDLVLTNCGAETSFPAPAHRLFVNDSNMVSMLL ALGAQDQVIAVSSLQRDADTLRKHYGPAAVDGLSDVAPHSPSRETVLAQRPDVMVAGWNY GYTEAANLTPDSLRKDGIAAYILTESCRQRAGERARGVVEPWTALRTDLTNLGAITGRTE RAADLVADLDTRLAALHAAPQAPRKPAVFLFDSGSDTIFSSGKFGAPQAILDSAGARNIL DDVADTWTKVSWERLASADPDAIMFVDYPGQTFEQKVELLRGKPGINELRAVREGRFLNL PYVLWTSGPLNIDAAEQIRARLEQWELLPPSGIRPRADDEVR
n-region:MNRPVR
h-region:ILAAAALAAT
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54023811|ref|YP_118053.1| MGTQRNKLFVLVAAPVLALAACSSGPEQPRTVAEQFADALNADDVAAAAALTDNPDQATA TLNQLYAGLGKEVTYEVRGTEGDTFTLAATWKLGSAGQEWTYTTTGTAAENGDWAIRWNP ATLAPGLDKGPLSYGPAYARPARVLDAAGGELMTEQIVTLVNLTAEADTAAVAALLNPLA PGITDASLRADIAAAQGKPVTAITLRAADIAPIRDALAALPGVTLAPQTRLLTTDKALTS PTLSGLAELWQQQADEAAGWAVRAQTPSGTERIAGAEPRPTADIVTTLDVGLQRAAEAAL APMDKPAAIVALQPSTGNVLAVAQNSAADAQGPIALTGLYPPGSTFKTVTVSAALQAGEV TPDTVVACPGSANIEGRRIPNDDNFDLGQVPLHTAFARSCNTTMGMLGVRLPADGLTHAA AQLGLGIDYVTPGLTTVTGKVPAADSPAARVESSIGQGQVTASPFGMALVAASIARGSVP APAIVAGRPGTPDRQPDPLPAGVAEQLRTMMRETVTGGTATELADIPGLVGKTGTAEYID DTHAHGWFVGIAGDLAFAVFAEDAGSSAPAVAAAGRMLRVSQ
n-region:MGTQRNK
h-region:LFVLVAAPVLA
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54023817|ref|YP_118059.1| MRPVTLPTIVIGCYAVLASFAFAATLTETILFYPNVFHDVPRSLELTEEFMSAVGVGDVL RPLGAVLTLTALVAAAVATRYRVARGWLVASLASLITGQFLLSVGYQWPRVEILFDDRAA HTTAELERAASEFLVGQVLRVGAAGLTATFAVLAALACHRAYVLAAARRDLETALA
n-region:MR
h-region:PVTLPTI
c-region:VIGC
Superfamily Assignment

PSA tool

>gi|54024225|ref|YP_118467.1| MKTLRKAAAAVATLATVAVLAACGGSPSTTAPVDGSWDDVVAAARQEGKVLLYSSQKPAN LQVLEKEFEAAYPGIDLEFVRGTDADLNPRVETENRTGRGTADVHMITDATWIAGAAESG RYSTELVGPSLSAPEFRTDTTVLNNRFALTSAAVFALGWNTTAVPEGLSSPRDLLDPRFQ GKIGIVNPTGIASYVDLYRHYAQAFGPEYWERLAALKPRIYPSALGVAQALTSGEIIATP SVQPLVTEVAAGAPVDWKLPESPWGTPWYTHALGVAPHPNAAQVLVDFMVTRAGQTALNS GYAAVLPDVPGAVARAEDISMPDTADLSPQLVGEYSQQWARLFQS
n-region:MKTLRK
h-region:AAAAVATLATVAV
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54024574|ref|YP_118816.1| MTLRRPAGRRAAAILAPLALAALLTGCGDDQPAAAPPATATTPRPPTTATPPPVAALPTI DPYADVPLIDRVEWTDTVDGDRLLVVPTRAGRDTTFPGAENRAWAEIVELSPAADSPGMR DQFVCHWHWARLVQPDKPSWNLEPWRPAVGYQETVRASCNPGGPER
n-region:MTLRRPAGRR
h-region:AAAILAPLALAAL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54024668|ref|YP_118910.1| MTAPSPRRRAFSALPLAAACALLAACGNALETDQPAVPATPTDPGFEMTIAPPSSSVTDV PDPDRISPEAATALCDTIRADLDSWRDQGSIIARVSFNGAVHNWAVRNGGLNDAVVRDRS VVDTATTAQCPDVRDQALEVLDVPDLAAALAGF
n-region:MTAPSPRRR
h-region:AFSALPLAAACAL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|54024726|ref|YP_118968.1| MTFRTRTRTTIGAAALASILALTGCGGGGTEAKAPGADGATTEVSLMLNWYPYGEHAPFY YGVQEGIFAKHGIDLKISAGQGSTKTAQATGANQTDFGWADTPAVLSNIDKGVKIKSVGV FLQTTPSAVQVFADSDIRTPADLAGKTIAVSAGDAPTTTFPMYLDKAGVPADQVTQQSLD SAGKMSAMLSGRVDGLIGFAHDQGPTIANKSGKEVRYLRYSDQALNFYSNGLIANQETIA SSPELVQAMVDATSEAFAAAVAAPEQAVAAMEGKDPQLPPQSVLLEQWQQTIPLLSTPET AGKAPGTNVEANWRATVEVLSEAKLLEKAEDPAKYWDSAFTPASQP
n-region:MTFRTRTR
h-region:TTIGAAALASILA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54024759|ref|YP_119001.1| MMRYRSVLIAAALSVAAVSITACGPKDTSAACSGETFNLHSHPELLGAENDLVRAFDEAA EQQLASATMVEMTTRAGWSPEWERVVYIGARTTDEELRKDSATDLRLACFAGLPTENSDP DLRSSHVTLFLADGKPLQAVWWVGQTPSLRFGKRDFLLPDTVLRYDPDSRTMRAE
n-region:MMRYR
h-region:SVLIAAALSVAAVS
c-region:ITAC
Superfamily Assignment

PSA tool

>gi|54024887|ref|YP_119129.1| MRPGGTMSATLVGAVALLVLSGCSAEDPDSKVPTREPATAAPAPATTVPAEGTVFGPADP VRALLAESGTGRLAVLASSGEAATTLLLIDPAGAGDVPAVPAQTVTLPAAGVALAQGAPG EVLIPMRDRVVRVDATTGAQSEIPVPGELRSVARADDGTLVVGAADGEVSTIAADGRVEH SLDGLVSADVVVRAGERLAVLDRRQSSVTEISPGADHLGLALRAGEGAATMIADHFGRVL VTDTADGELLVYTTGPLVLRQRFPVGSSPYALAYDRRSETVWVTCTQSNEVVGFDLSTGI PQEVGRYPTVRQPNTVTVDDRTGDLYVGSAAGEGLQRIPADRLKRGQ
n-region:MR
h-region:PGGTMSATLVGAVALLV
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|54024894|ref|YP_119136.1| MPGRALRILAAPLVCAAVSVSACGDLSGPAPTTHHSTSTPVPASHPSSTAAAAPSTSPAP APTSTSSPTAAPATPRPAPPSPAQQPPPPPAVAPPLPAAPGPSCHPSYDPCVPITSDVDC SGGSGNGPAYTGRVRVVGPDEYDLDRDNDGIGCESG
n-region:MPGRALR
h-region:ILAAPLVCAAVS
c-region:VSAC
Superfamily Assignment

PSA tool

>gi|54024950|ref|YP_119192.1| MTRPLGYAALVALTAAALTACGSDEPTAPRAEDFASASTAASNPAEDAVVIDVRIAGGTV TPTNAQAEAKVGQPITLVVDSDAEDELHVHASPEHTFPVRVGAGQRFTFTVDVPGRVEVE LHDAGRTVTTLLVRP
n-region:MTR
h-region:PLGYAALVALTAAA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54025150|ref|YP_119392.1| MLLPAKSLRLCVATAAAALVLTAGLAGCSDDESSDTAATSTSAAATSAAATSSASGDHDH AAPTAEELQGTLTLFADPAKTTADKTAVVVDGDKRAANIDTMNQVLGGYGPLTFAISDIK TEGESATAQVVITSPHGVAPAMPLTWQHEDDKWKISDASACTLLAFAQAPCTP
n-region:MLLPAKSLR
h-region:LCVATAAAALVLTAG
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54025219|ref|YP_119461.1| MTRCGTTGPRLALLAAVVALLAGCGLVSSSGTFHDARLPDGARPLAGAELVVTSKSFTEG VLLGKITATYLAAAGADVVDMTGAPGSASSRQAQLNGDADVLWEYTGTGWVNYHNRTETI SDPQELWRQVHDIEKSEYDLEWLPPANFNDTYAFGASRATAERLGVRSLSDVAALPVADR TFCVDDEFFSRSDGFLPMLQTYGIPYNDPAGVPVANVTRMDAGVVYTATAKGAPCHFGMI YTTDGRVKNLDLVVLDDDKKFFLPYSGTAVVRAAVLERHPELRTLLGTISERLTDDLMQE LNGRVDIDGEDPADVAYDWLRQEKLIE
n-region:MTRCGTTGPR
h-region:LALLAAVVAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54025462|ref|YP_119704.1| MHRLGRTAAGVIAVIALLLSLTACGDDIESARDYIAAKYTRASSLDQVNDGRAYTAALAP AAAVGAITAAARPLDNRTLGERTYLQYRDDIITVAPHGAGALILVDQYRNGYQRHHSTVS GFGWPSQPPGSEYRSSSGK
n-region:MHRLGR
h-region:TAAGVIAVIALLLS
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54025500|ref|YP_119742.1| MNIRRSRPLVSLLAGFALALTACSGSGADSRAINDRGFPETLTLAAIPAENSTDLKASYD PVIALLERETGAKIDFVQASDYAGVVEGIIAGNVDMAFFGPFAYVVAGVNGAKMTPLGAV VQEPGGKPGYQSYGLARSDNAVIESLADFAGKKVCFVDPSSTSGFLYPTAGLIEQKVIAS GAEADLSKGLTPIYAGGHDASALSIAAGDCDAGFAFDTMVDKTLVEKGDLAPGQLKTVWK SETIAGSVFAAADALGAETVAKLRTLFTEKVNADHLRGAGLCTGECRITDERAWGVVPAA DSDYDGVRHVCEVTRSDKCAG
n-region:MNIRRSR
h-region:PLVSLLAGFALA
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54025550|ref|YP_119792.1| MSTTAPVRLTGRQWWLLVVSCLGVALVIAAMAGLYTALPEIAADTGASQQQLTWIVDGYT LTLACLVLPCGALGDRYGRRLVLVLGLVIFAASSALPLLVDSPHWLIGARALTGVGAALV MPATLSLLTASFPESRRSVAVAVWAGVAGVSAVIGFLGSGLLLAHFSWVSIFLGMAIAAA VLAVAGCTVGETVDEDRPGLDPAGALSSAAAIGLLVVGAIEAPVRGWTDPVVLGVLAGAV VAGVLFAVVELRLATRGARPLLDVRLFAVRGFGSGTVAVGVQFLAAFGTFLLIVQFMQLF LGYSPLMSAVALAPMVGPMIALAAVAPWLAERFGLRLPTVIGVGLVGVGLIGLSRLTADS GYVDLLWPLLVMSSGLGLSSPPATAAIIANTPVADHGVASAVNDAAREVGAALGIAVAGS VLAAGYSARIGPVLPQLPEPAREPVGSSLAAALEVADRAGPQAAPLVDLAQAAFVHGMQN AALALGVSSVVAAVVLGAWAPGRGARGSAEAGDVAEQAVR
n-region:MSTTAPVR
h-region:LTGRQWWLL
c-region:VVSC
Superfamily Assignment

PSA tool

>gi|54025556|ref|YP_119798.1| MAAPLARLAIAVLAAAALSACTSDADSVPAKESTPPDRSLRGTTWVVTALLDQDVDVPAE VLDAANPTLLIAEDGGVSGSAGCNQLVGTAAVQDKPHGGSSITFQVATTKMMCEPAVMEV ERGVLEVLDGNVGATIEGDTLTLRDDDGRGLTLAAR
n-region:MAAPLAR
h-region:LAIAVLAAAA
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54025659|ref|YP_119901.1| MRQPRSVAVRLAGACTALALAAGPVTGCSGQSQVPSVGYGVDAVITTYNGGSTLGVSSGS AAVFQRVLTGFFYTGPEGQQVADTDAGTAKEVPGESQTIQYRLNPDGVYSDGVPTSCDDL VLTWAARSGRFTKAGPGGQVPMFDAASTAGYADIERVDCEPGSKDATVVFRPGARYLPWR TLFAAGELMPAHVAARVAGVPNVVSVVQSGDPAAMQRLADFWNTGWNLGTGDLDLSRFPS SGPYRIESFSPRDGLVLVANERWWGNAAETGRVVVYDKTVDLKAKIADNAVSVLDIGAGS IPDLDLAGFTASTVPGRGAEQLVLATGGVLGSVEARRAFARCVPRQALYNDLGKAAEIPS TGLGTGPLNSLITQQDSLFYGATTGAAEPYEVTDVAGARAGFAGTPNPTIRIGYLSPDDR RAQTVARIAESCKAAGITVVDAGAPDFRPNQLSEGAVDAILASTGATPGPAGSLTGTVAA AALRTGNGLDFGRFGNGRYDAITDQLAADDDSATQLNLLTEAENLLWSEMPSIPLFATPR TIAFGNGLHNGVAGPTQGGTGWNMDRWVLRR
n-region:MRQPRSVAVR
h-region:LAGACTALALAAGP
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|54025703|ref|YP_119945.1| MRWTRAAVLASTLSIVIAGCGAGPSDRPGVAVERPGVGGGPAPEETTQAEPPRAQVPTAD LSWHDCTAPTLNLLGLGPAPAGLMLECAEYSTPIDAAGSVLGNFRNGAVRARLPQTPTDV PPLVLTSGNDRSSSATLAGLAVGPAAPLLATRPIVAVDRRGIGTSQPIDCLPPEIRGGLA EHARGAADPIARMAELSQEATISCRDFLQPYESTFDAAHAADDIEQLRKQWQVEHIDLLG SGNGATVAIAYARKYGDHLARLVLDSPEAVGTDAVTREEQRLQGAEAALTAFAQRCTALG CALGADPRAAVADLVRRADAGELGTLSAAGLLTAITGFLGAPRADQATRVAELADALAAA GRGDRTALDNLVLRESAATASDGQFVNRCTDIQQPPTAVQAAELAQAWGQKYPVFGRQAA IGLMTCSAWPVSAAPPLPEELDLPVLVLTGVADPVVGTGGQSSVTGALGSAGARHASVSW QGWGHPALPHSGCAQQMVADYLAEARLPRDGSACPA
n-region:MRWTR
h-region:AAVLASTLSIV
c-region:IAGC
Superfamily Assignment

PSA tool

>gi|54025780|ref|YP_120022.1| MTTRTTLRAAIPAVLATAALLAGCGDDSGDHDTHATTASSTTAAAITGATGAAAHNDADV AFAQEMIPHHRQAVEMAALVPERSTDPRVRDLAARIQQAQDPEIATMTGWLRSWGAPVDG GGHAGMGHGDMSMPGMMTDEQMAQLRAARGAEFDRMWLTMMIAHHEGAVQMSRTELAQGA DPAAKALAQQIIDGQQAEIDQMRGLLQG
n-region:MTTRTTLR
h-region:AAIPAVLATAAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54025855|ref|YP_120097.1| MIGRGGRAVGALAVVAVLAGCGGADADNAAAQGPTEESLRTAAEQMTEALAAGDYPGAYQ FRSARCRLTLGQDAYVEEMTQRYAGRDLKAAEPEITVTVTGTTGRVTVRHTDARASEDES APATWTFVDGGWRYDTC
n-region:MIGRGGR
h-region:AVGALAVVAV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54025907|ref|YP_120149.1| MGYRSRIRSWHLWLVVGVVVVACEAIAPPGELLSEGVDRALEKHPLLTRAAIGVTARHLT NDLPAAVDPFAAVHRVSTRLAQRRSVRPPAQQPV
n-region:MGYRSRIR
h-region:SWHLWLVVGVV
c-region:VVAC
Superfamily Assignment

PSA tool

>gi|54025920|ref|YP_120162.1| MGKTSIEWTERTWNPVSGCDKVSPGCDNCYAEGIANRFAGGTAFPNGFQVTLRPEKLSEP LRWRTPQRVFVNSMSDLFHKDVPDEFIARVFATMARAPQHTFQILTKRPGRMRSLLGDAI DGPQRLLEAATDEDTATAIYDAPWPLPNVWLGVSAENQHWANLRIPTLLGTSAAVRFVSA EPLLGPVDLTRIPFQAGTATHLDALNGRYGHPGRWEAAAEKLDWLIVGGESGRGARPMHP DWARSLRDQCTAAGVPFLFKQWGEYITTEQMTEATYMTWDIEHGSAQYHPSVQWRVGKKR AGRELDGRTWDEFPVRVSA
n-region:MGK
h-region:TSIEWTERTWNP
c-region:VSGC
Superfamily Assignment

PSA tool

>gi|54025937|ref|YP_120179.1| MTSMKALAVAAAVTLAALGLTACGEDRWCEHDDTDTRVADSYCAADTPGYEWEPDYDHHQ KKPTTKKPTPTKKAR
n-region:MTSMK
h-region:ALAVAAAVTLAALG
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54026087|ref|YP_120329.1| MSTRILIPVVVAMLVAAAVVGCSSGPQGPVPVAESFLSAFAARELDAAAELTSQPEKASA ALASAWEKLQAEELTARSGAARVTGDTATVDYSYEWRLPKNRVWSYTGQLQMGRSEGRWT VRWTSSNIHPRLGDTQTLALRTTPAPRARVNEQSGSDVLVPGEVTRVAFSPADAPDPAKV AGALSAALLRFDKKLTPEAILRAARAADGPYTVALLSEVEYNEVGALLIGLPGVRLNQEW DMVSTERGFAPDLLTQIRKTVIAEVDGKAGWSVVTQNANGVDTDVLTEVPAQPAPSFALS IDRYVQNAAQRAVDVPKEQTMMVVIRPSTGAILAVAQNEAADRDGPMATIGQYPPGSIFK TVTAAAAMHEGLATPDTIVPCPSQIVIGERTIPNYNMFSVGSVPMATAYERSCNTSFAKL ASELPADALHVTAAGLGVGPDYTVVGLPTTSGSVPPAEDMVQRSEDGIGQGKVVVSPFGM ALMAATVANGSAPVPWLIGGRETIVDGERPAIDPAVIEGLRLMMRKVITGGTATRIVDQG EVYGKTGEAEVEGGSHSWFVGYRGDIAFATLLVKGGSSDNAVAVTRDMFAALPPEY
n-region:MSTR
h-region:ILIPVVVAMLVAAA
c-region:VVGC
Superfamily Assignment

PSA tool

>gi|54026168|ref|YP_120410.1| MRTTNRPWRILPATTAHARGIAACHIASWREAYRGLVPAPILDAFDVDRRAAAVTRDLRD DRSGRTRVALVGDDVIGFATAAHGELRALYVRAGWYGTGVADDLLDAVLDPGVATSLWVF EDNPRARAFYRRHGFTASGERGPEAFTALPQVRMVRPAAKVPSMTSTEQTEYITTADGVL QITIATAANGTALDFAGIAAGTTALRERGAEVGAVLLTGTGANFCAGGNVRGFAAAEDRG AHIHGLATDLHEFVRALDATTVPVVAGVQGWAAGAGMSLVLAADIALGGPSTKLRPAYPG IGLSPDGGMSWTLPRVVGMGRAREILLTDAVLDAEEAVRLGILSRLVADDAVREAARELA VTLARGPRTTYAGMKELLRASLTSSLSDQLDRERDGIAAAANSPAGREGVDAFVQKRPPR F
n-region:MRTTNRPWR
h-region:ILPATTAHARG
c-region:IAAC
Superfamily Assignment

PSA tool

>gi|54026207|ref|YP_120449.1| MRLVAVGRVAMCVALGSALLAGCARFDDSASSPFTPEPTFSPADPRPPDQPPSSTTRPSG PCIDPDPSVVATCLDTTGGLVGVGHGALVAERRTGRILEVVDPDTPPVEVATVSVDGSGD GGLLDIALSPTYSEDGLIYAYITTGSDNRVVRLAEGGPPKDILTGIPKGATGNRGALEWA TPDRLMVLTGDAGNPGLANSPGSLAGKLLRLDSPAPGSAAPQIVAAGIGTPGDLCRDGSD NVWFTDRTAVEDRLQRMDPSGAVSVAWTWPDRPGVAGCAVAADGVAVALTYAKALAIAPT DPNTLAVTTAPTLMVQDRYGQLGGATIGPDGTVWVGTVNKAEGTPGPNDDRVVRVPPPSG GGGGGPD
n-region:MRLVAVGR
h-region:VAMCVALGSAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54026210|ref|YP_120452.1| MRVMRTGRLLVSLVAVLVAVAACSSGSEAPDQVSGAWHGVIEVPGQPLAVGIDVTGPDSA TIDIPAQGIDGLALRDVRTAPGDVGFVLPGIPGEPTFKGALDREKDRITGDFTQFGQSVP LTLEPGELAPPNRPQEPKPPLPYRAEEVTFRSGEITVAGTLTRPEGTGPFPAVVLITGSG AQNRDEEIAGHKPFLLLADTLTRAGYAVLRTDDRGVGGTGGDLETSNYDDLADDAAAGIA YLRGRPDIAPDRIGLLGHSEGGYLAPLVAARPDSGVAFAILMAGPAVPGGDALIEQTRAI LAASGVPAEEIDKQVSDTTEMVGLLRAGDIEGARAVFQRRMAQLPPEMRESMTEADNPIT PYYAAFVAYDPAPALAALRVPVFAFFGEKDLQVLPGQNEGPARQLLAAGPDATVRVFPGL NHLMQPTATGAIDEYSTIETTIAPEVLTAVTEWLTDRVPPR
n-region:MRVMRTGR
h-region:LLVSLVAVLVA
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|54026223|ref|YP_120465.1| MSLGRSAVQGGLAVTMLVLASCGLMAERVEPQATVLVAAKSAAWRGHTIDRPDALAVEFT QTQPRLRGQVGLAIMPVGGNRTTVFGNWTTGLAWSTIKVPLAVAALRRDPEGAMADAEAA ITVSDNDAADALWDSLGDGLAAAEAVQQVLDEAGDATTGVPGPRTRLDYEAFGTTEWSLT DQVRFASRLPCLPQADAVTQLMGRITPDQGWGLGTIEGAIFKGGWGPDDETGVYLVRQFG LVPARNGLIAVSMAAQAESGDFTDATHLLDDMAALLARHLDQLRGGHCAH
n-region:MSLGR
h-region:SAVQGGLAVTMLV
c-region:LASC
Superfamily Assignment

PSA tool

>gi|54026314|ref|YP_120556.1| MRTLRLAAALLLSTALVALTGCGAGSDESATRAEIQTLRVGVIGTGNVLTGTLGFAHQRG ALLPALQPLGVDAIEVYSFPNGPDLNQALVGGRLDVATYGDTPALVAKGSGLPTRLLAVN AVGLNAGVVVRDPALRTLRDLAGKKIGVQSGSYIDRYLQGALRAEGIEAELVHLLSADAE APLTNGDVAAVALPDVNPSSFLQAFLAKGFRLVDSVRENHPELAGTTAAVSSQPFLDTHP EFGPTWQRALTEANAYAAAHWEEYVAYEVAQSKAPEAVVRATAHPDYIPTGLFDEAGVRL LTGTKEFLVNQGKIRQDFDLHEWFYQPEGRTAG
n-region:MRTLR
h-region:LAAALLLSTALVA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54026452|ref|YP_120694.1| MRTIGRRHRLFHTAVIGSVLGLALVTGCTDAAEQAGPGVTDAPCPQALDESKGCIYLGVL SDLADGPFTALGSSIHDGQRAFWHAVNAAGGIAGREVDISTYARNTGYDPQRHRAEYARI EPHVLALAMSFGTAQTMGVLPEMEAAGVVTGAGTLWSGWQYPDTDRNLVLDYGFSYCAEA VLGLDWFSGAHYLPSGIGIVAYRGNYGGDYASGAMRWAAANGIPVTARIDTGPNSEVGNQ DGPVATILASKPDVVVLATGPVEAAEIIGKLVAGGYQGRFLGSTPTWNSALLRTPAAEAI TALYNYTSPFDGWDGHSAGAAKARAATTEPPANWGYNLGWATSYPMKELLTAAAAQGPLT RAALRRALSGLTVDSEGMAPQRRYGTDRPDLAAERAVISVPDPDAPLGSRTLAADYRGPT LERITFSGPCARL
n-region:MRTIGRRHR
h-region:LFHTAVIGSVLGLAL
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|54026496|ref|YP_120738.1| MWGSRISHSIGTLALVVSCVAFGGDEHAAAIDHTYAAASSSELLVVRGAEIVARASISPL PWGGKTVMTNDRRHYARLSAVPGTAEQDEDGQVELITVSVADGRVVRRECPGCTSAAAIG PTEVVVTSTLGGGLFDTVGALLVFDAATEDAPSRLTPRPPGVNRVQQATEFVAAMGLVAG SDEAAFAIGYDQAATMAGMYRLDRFGGVRFEGLRRYYGFRDEDGRRWGLVDTTAAPVVLA ESPVMGMAFASTYEADEPAREDEPPTDNVGCTRHTLIDIVDGTGDVRTLRIDDAVRAAGM DPSSVGTVISRLWQSPDGILRGVVRVRGCDPKADAPSYWDLVVDGRGVRLLGQRQPVSRF GSGAAAVTVSEGFVQGERPFAVRTGDEAEWGEFLEITGTAMGLRETSPLNRALPLPETVG DRTRLSTVRPVDNTRKLRAEYDVQRRIDGACRDSRHRVARVLLECTTAEGTHELCWAGQP SNTAYCLDDVTGRSVVEVRSRSGRGVGVVGASDVVGDGVVRIPLALRLIDGRTCALDSHV PPDAHDHTYTCIDGSQVLDNQNSGPTAFVADGTLFTASHRALDGTLTDIPITELFLVQSN
n-region:MWGSR
h-region:ISHSIGTLAL
c-region:VVSC
Superfamily Assignment

PSA tool

>gi|54026582|ref|YP_120824.1| MTMRAARLSGSTGLTAALVAVLLVLTGCASLPESSAPQALGTIDREPTSEGPTPPIAGRD PDLLLRDFLQATADPTNRHLAARQYMTPAASAQWDDSTSTTIVEKPDTLLESRDGDRATY RIRAQRMAELSADGAYRAVNEPTLENKIEMVKVDGEWRIAELPDGVVMDITAFTKSYRRY VLYFADPSGNTAVPDLRWLSVPKNQLTQRLLSLLSEGPHGAIGAVVRNQLAAPVALRGPI TKANGDPDDVGVGLGGVRLDFAGAAALSQRDKELLAGQVVLTLAQADIPGPYMLLADGRP LDERYATNGWSAADVEYLSPSVQAQNRIGLHALRDGALTQVTDNGVVETPGYFGSVNNLQ SAALSPDGQLVAAVADAGRPAPEPPRTLMVGTYGGPAFPVAEGGSITRPSWTGDGSAAWA VIDGDRVIRAVNDRATGTVSVQGVDISGLTADPAGPALRLPITELRISRTGVRAALIADG KVYVAVVERRPDGGYALTAPVPVAVGLSTKATSLSWIGGDTLLIAREGNIDPVSTVLIDG SEWTPVTSQNLTPPVRVITAAPGAQYVADSRGVLELTSNTTSELHYWTEMPGLVGTDAAP VLPG
n-region:MTMRAAR
h-region:LSGSTGLTAALVAVLLV
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54026671|ref|YP_120913.1| MTGRPWSPTGSGGVTEFPNRAMEDFVIACGDGTPLFLLANVVDDVDERITQVIRGEEHLS NTPKQQLLWEALGHTPPVWAHLPVIVNDKRQKLSKRRDKVALEDYLAEGYLPEAMVNYLM LLGWGPRDDGPEIRPYAELEAQFCIDDVTKASAFFDVAKLRAFNGEYIRALPLPEFIEAC RPWLVRPVVPWPEQAFDAQVFTPRCGTGPATHGSGR
n-region:MTGR
h-region:PWSPTGSGGVTEFPNRAMEDF
c-region:VIAC
Superfamily Assignment

PSA tool

>gi|54026785|ref|YP_121027.1| MHHHARRSAGFIAALAAGTLIVAGCTDDGDNDNAAATATTGPMATMTTTAGADETTTGAE GGTTTGTAGATTSPGGEDSEAGEQTRMATPDGTEVTVSGDIYDKYMAVGGPSSPLGAPLQ AEEAGPNGGKYQDFVGGTIYEPAEGEPHIVWGEIRKAWEANGGANGELGYPTSDETDIPG GKQSTFTGGTITWVNGQTNVTMR
n-region:MHHHARR
h-region:SAGFIAALAAGTLI
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54026834|ref|YP_121076.1| MSKRTGVLAAALVTLVVAGCGLGQDLPPIPEGIPPGPGAPLPVIDVDAPGRAALQLRDWA ETQFGTLGIPTVALEAYGYAAAVMARSRPGCGIAWTTLAGIASVESKHGTHRESDLHADG VVRPPIIGVALDGSPGVAVIRDTDGGALDGDPEHDRAVGPLQFIPETWQRWGVDANGDGV LDPQSIDDAALTAARYLCASGGDLTSREGWQQALLTYNQSTSYLHTVRHRAAAYSVGRRV
n-region:MSKR
h-region:TGVLAAALVTLV
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54026847|ref|YP_121089.1| MSARVRIGAALVAAVASATVVAGCGSGEPARFGGVPQSCARLLAPAVAEIRAFAGALYTE GDFEQPQTAAATDPDRPSRACGGAYPQRPVAAPAPGAALSRIVSVVFAVQRGDDPVAGAA KYLDVAAGSAEGVRGHEVGDESYSGTPPFAETGAVQIGFRVSNAVVTVSVVGTDAALREG GAPEPVPTAELSTVATGIARTLAADLDSVLPG
n-region:MSARVR
h-region:IGAALVAAVASATV
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54026888|ref|YP_121130.1| MSMKQSWMASVAIIGMACTIASCGESEDNATVRATTTAPIPSYFDPCTDISPEFIAAHNF ESPTPFGPGPAIGPTPGKGCYYVRPREYTVSIAVTGAALGSAAEWQKLTYEEIVVAGRPS EIAGPQDGRARGGGTIGNLRCLLHVQIAGGMLTFSYYDWGLTPNPPHPCEAVTTIATEVL GMLPPGS
n-region:MSMK
h-region:QSWMASVAIIGMACT
c-region:IASC
Superfamily Assignment

PSA tool

>gi|54026905|ref|YP_121147.1| MHRIRPRRPRLAGAAPALLAATLITALVAGCSSSDDGADTASAPATGPLPDAAQIVQESA RTTQTLQSVHLDLDVNNIPNLPVETVSADVTNQPQGAGQAMGEAKVRTAPDAPFVDTKFI VVDKTLYTAVNSTNYAPVGPAEKVYDPGVILDKDKGLANVIAQVQNPKAEGRETIEGTNV VKVTGTIDASVIDPIVPRVGENAGTLPITLWIADVPPPSTSASVLPSQAASPGDGPNLVR ALVTKDQGTVEVTLSKWAEPVNVVKPQG
n-region:MHRIRPRRPR
h-region:LAGAAPALLAATLITAL
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54027054|ref|YP_121296.1| MPGMRIPSALITGLALVLTLSACGSGGDSGSDTPLRPPPKVASLGPFVGECGHVTDDEVR DIAGLGTLSQVFKNSVGCNYQSAGIGSPSVTFASYRGSPIEREKAWVSNVGRAPDAIEVG GRPGFAALDPSGAVCDLAVQLDDDFFEWSMSYGFFGPLDNPCDKTRKLAELTVARLK
n-region:MPGMR
h-region:IPSALITGLALVLT
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54027170|ref|YP_121412.1| MSYRPLTRPAAVVAALLAVLALLAGCTIDRSGDDNGGGRGPVAEVTMDPGDGATEVNPVA PVSVRVEDGTIAQVALTNAAGKQVAGELAADHRSFRITEPLGYGATYTWSGTAVGTDGAP VPIEGSFTTLTPANTQPATVNIGDGQEVGIAAPIILQFQGAVQDKAAVEKALTVTTNPPT EGAWAWFPDDNGGSRAHWRPKQYWTPGTTVHVAARLYGLDLGGGNYGAADLTTDFTIGRS QIVRAHAPSHRMQVVRDGEVIFDFPASYGEGNEARNVTRSGIHVVTEKYEDFLMSNPPYY ENVRERWAVRISNNGEFIHANPASLAAQGSANVTNGCINLSPEDAQAYFPTALYGDPVEV TGTSIALSAADGDLYDWTIDWDTWQTMSALDGSAAPVVSATPVTPGPPR
n-region:MSYRPLTR
h-region:PAAVVAALLAVLAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54027262|ref|YP_121504.1| MKRFSVVVLTVATMAAALAGCGGSDSDSGSAAASSTAASSTTDKAAQTTCAEFKNLDTEA EKAVVEAILAENPDSPYAGSPNVALGTAKLVCLSEANAGKTVAAAAGLLAAGK
n-region:MKR
h-region:FSVVVLTVATMAAA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54027317|ref|YP_121559.1| MRARRSLPAALLVALAALTGCADGPAPVARPPAGTYTETPLPAGATVLPPESPLPAQPEA DCGDPTASLRPTGATTGPTLDAIRRRGRLLVGLDTGSNLFSFRDPITGAVVGFDADIARE IARDLLGSPDLIEFRSMGSADREQALQDRTVDLVAKTMTITCERRRKVAFSTVYLRADQR VLAMKDSGIRGLADLAGKRVCVVRGTTSLEHVRREQPAATVLTVPSWADCLVVLQQRQVD AVSTDDAILAGLAAQDPYTEVVGESISVEPYGIGIPREADDLVRFVNRTLERLRSDGTWT RLYRQWLSVLGPAPAPPAATYQD
n-region:MRARR
h-region:SLPAALLVALAA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54027499|ref|YP_121741.1| MVERRQLLSMIAAGTALLLTGCTAASEAADSAVDAAAPPVPPAPPVPPAPPEPSAPLLPP PPGGPRTPIGRTTITALPGPGTNLALTVDDGASPEVVGAYLRFARDTGARFTFFVTAHYE SWTIHRAELAPLVESGQIQLANHTWSHADLTAVSRTAVAEELSRAQSFLRNTFGVDGTPY YRPPFGRHNAAVDAVAADLGYTVPTMWYGSLSDSGLITEQFLVECAHRWFNPQAIVIGHA NAPTVTKCYGQLVDIIRARNLSMVTLNDVLEPPA
n-region:MVERR
h-region:QLLSMIAAGTALL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54027610|ref|YP_121852.1| MSRQLVSGLALAVGATVAAFTLSACSSTIDGRAQPAIDGTIDAVTTSTPKPSSPRSSSRP SPTKEEGDTDFEAGIGDCVTLGGTTMNATIEKASCGSRASNYKIIAKTATSSSCPSDRDN YYAETLNGIEQGAYCLDIDWVVGGCMDVGGDDPKRIDCTERGLQGVRVTEIAEGASDAGA CGSGLGFEYPERRFVVCVEEL
n-region:MSR
h-region:QLVSGLALAVGATVAAFT
c-region:LSAC


References

  • Madan Babu, M. and Sankaran, K. (2002) DOLOP - database of bacterial lipoproteins, Bioinformatics. 18:641-643. PDF
  • Madan Babu, M., Leena Priya, M., Tamil Selvan, A., Madera, M., Gough, J. and Sankaran, K. (2003) An updated version of DOLOP with functional assignments to predicted lipoproteins, Journal of Bacteriology, in press.

 

This website is Maintained by M. Madan Babu * and K. Sankaran #
* MRC-Laboratory of Molecular Biology, Cambridge - CB22QH, U.K
# Centre for Biotechnology, Anna University, Chennai - 600025, India

This site is dedicated to Prof. Henry. C. Wu
Last modified : 14th April 2005