47 predicted lipoproteins out of 3027 predicted ORFs for Legionella pneumophila Paris


Functional assignment
Protein sequence
Signal peptide features
Superfamily Assignment

PSA tool

>gi|54296001|ref|YP_122370.1| MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDSKNIPYIAWWRDFKDP TLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLMTGYSRNPATGFPGVLI VFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQITASYFTYLAEIERKEFLQ TLANDLTQLAKVASKVYQGGLSSEIEQEELYSQVNLIQGELEVTERNIVISRNALRYLLN QNPGEIKTVKKLLQLKNHKLIPGSLPLTVLENRPDMQVAENRLRASHEGIGVAESNLLPT IQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVLGAVAKAKGVNKVSYYNYIDT LQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLNDRLYQTGIQSYIETLNSKISL DKINISLNQDKLQELLSIVRLYQELAGGYRAKLESEIKSSV
n-region:MLRPVK
h-region:IILLSVF
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|54296061|ref|YP_122430.1| MKKLIILGCVIFMVTSCSFAPKYERPLMPVPEHFKETGKWVPAKTVIPSSKITPWWEVYN DPVLNKLESLIEVSNQDLKKIFYRYQEALALVQVSRAGFFPSIMGTLNANRQQTSTTMAD PSTIPLYNNYIIGSQVNYEIDAWGSIRNAVAAQQNTAHATEAELAAISLSLHAELASDYF SLRGCDESQRILDATVAAYKKALYLNKKRYHGGASPIEDVDQAETQLENAKTAAADMRLK RAQFEHAIAILIGQFPADFSLAPAKLSRTLVTVAPDLPSTLLERRPDIAAAEFRVQAANA AIGVARAAFFPVLDLTGIIGFQSQSLSNLISKPSLIWSLGPISTLALAQPLVAQPIFEGG KLVGQLKYAKASYFETVANYRQTVLTAFQEVEDSLVAVKQLDKEIRSQRAATQAAKRALT QANNRYSGGIVTFLDVVVVENTALQTELAAVNVFTRRQIASVQLIKALGGGWVYLNKER
n-region:MKK
h-region:LIILGCVIFM
c-region:VTSC
Superfamily Assignment

PSA tool

>gi|54296150|ref|YP_122519.1| MKWLLSVLMIALLSGCSKPPDLDSPCHHFGQYCPQYPINDEPIMELTK
n-region:MK
h-region:WLLSVLMIAL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|54296151|ref|YP_122520.1| MNTLIKGLMVILIAATISACHHENPLKTQPAKASVRFLINASANAEKQLHFAIHKDAYGF AYLECMEGKQSPDIQCNALYQGMIAFAKEGHYAGFQMITQADLTDKKVFESLADEYAETA ATSFPHFVSGS
n-region:MNTLIK
h-region:GLMVILIAAT
c-region:ISAC
Superfamily Assignment

PSA tool

>gi|54296197|ref|YP_122566.1| MKEKTAKQLKLFIIYLLSYWLLSIISCLIAFGYDNSLRMLLASPKSDLSGALLFFSSFIA TALLFVFRYKTFSDQPYPYFIFGFYVGNVSLLMLFILDAFIRELIVWKFPEFLLVFISPF VELVLSYLFFGFAFLAIIPAVTSAFILYAVQRKLLLPPI
n-region:MKEKTAKQLK
h-region:LFIIYLLSYWLLS
c-region:IISC
Superfamily Assignment

PSA tool

>gi|54296237|ref|YP_122606.1| MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDNLSSTGMAIIEFSSAK TKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELYFNDFSKIMVQVGKEIA TVVTNPVQGTMITLIQKWATVCEIKQPDSLLAQAMLELLPLLSVEVEQTKNSLNILQKAN VVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQLTCTTTEYRYCTEAVLKS ASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIFTRLYKDYTIQYPKVDDMQR QHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIHVDEHHLLDKHCFEANYFYTQ LNSFRTYPKTSCMNPNLIEEKLAKIASHYDHVLVLSISSKMSGTYEAFLTATKKYTNITV LDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAIKNTYIFVMVNQFESMIRSGRVN KISGRIAQWVNIKPLVSIDSAGQGIMVGKCFSASRARNKLINFLQEKKDEAQLILEDYCI IHAGDKNQALHLAEMTTQAFNKPPTYIEPVSLAIGLHAGQGCIAIAGRLRERNDY
n-region:MPLDK
h-region:LTGITFHAAI
c-region:IAGC
Superfamily Assignment

PSA tool

>gi|54296288|ref|YP_122657.1| MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERYFWRTLHEGRYQDIPQ ADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLPNEIILSKKYFADALQL DPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWPEFNYFTAGYPMSSLSAD SDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGAQRACWNSEIAPHNFEGFF MNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKRVLNVKANVQHFNQKSNDPN QSIMFNSGYGCVVCHQR
n-region:MR
h-region:LSYGLLGFMIFN
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|54296308|ref|YP_122677.1| MRLLMSGWTCWFILFLSLGLSSCASEPTTVQQAVQNAVSRLTPEQLATYNATSDQFNQWN ASSQFNISTGELSFLIVGCGNT
n-region:MR
h-region:LLMSGWTCWFILFLSLG
c-region:LSSC
Superfamily Assignment

PSA tool

>gi|54296335|ref|YP_122704.1| MNKLIVAVTAGASLLLLTGCAVDGVAVDDVSYDSGYSNDYVYSVGYYSNRPYWGNNYYSS PSFVGPYGYWGGDYDF
n-region:MNK
h-region:LIVAVTAGASLLL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54296403|ref|YP_122772.1| MRHIYFALLLIVVTQASLCLSACGQKGPLYLPEQEKKPTTNQ
n-region:MR
h-region:HIYFALLLIVVTQASLC
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54296522|ref|YP_122891.1| MRKVFSLLLISSIIVISSCSEQKNQNTLRFSTSAEYPPFEYIENGEIKGFDIDLAKLIAK ELGKEAVFDNMQFSAVLPAVNSGQDDVAIATITITEERKKNFDFSKPYYFEGMAAVFDTS QPVKEISQLTGKKIAVQLGSVMEIWLHQNFPKAEITALDNNNQAIEALIAGHVDVVLMDG AQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSALENLKAKGEIQKLESIWI KGSI
n-region:MRK
h-region:VFSLLLISSIIV
c-region:ISSC
Superfamily Assignment

PSA tool

>gi|54296577|ref|YP_122946.1| MNAIKRLTIILICFLTACAPPRPSEEPPANREIPLEERKAETATVSSWEIKGALAAKTKA KGWSATMNWVQQGANSYQIRLMGPLGGGTVLISKKGNTITFQDGSKITTSTNADELLLKQ TGIRLPVNNLYYWVRGLPAPGGVQSEKHDQFNHLIQLKQNGYTIDFTKYTSVKGIDLPSM IRLEGNGVMVKVVIKNWVV
n-region:MNAIKR
h-region:LTIILICF
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|54296680|ref|YP_123049.1| MSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDRRAVKRVGVDTGIGAVAGVIASGTAS GTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPR LNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIA AKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSPAQPPQPQMAYVK
n-region:MSRKLAKTR
h-region:ILGYGLMICF
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54296728|ref|YP_123097.1| MKKIYWAVILMCLGLTSCVEFDESTLITDDAGYVHRTVHYLRDKRGRNYFPMQIKAPGER LFVFDPKASAWAAYDEEGHRVMTGAGSGGIDVCEENPNQSCRTITGTFRIYNKRGIDCRS GEYPVDTKGGAKMPYCMYFYRGFTIHAAYEVPEHPSSHGCVRVFPSAAKWLNEEFLRVGT KVIVLAYPDQNGVKTMSSLEKVN
n-region:MKK
h-region:IYWAVILMCLG
c-region:LTSC
Superfamily Assignment

PSA tool

>gi|54296750|ref|YP_123119.1| MKYLIPCVVLFPLLSSCTVIQEDFYQPEYLGPAPRVEVTPSYPQGHYHRHYNQRYHSNNR YYSAPRGQVHYEHAKTQGHAAVVTPPPSQARVEVQKNVHGHNANNGQVHGHAHDNGNVHS HPDSSNVHGHDTSNPEEQKKIHGHS
n-region:MK
h-region:YLIPCVVLFPL
c-region:LSSC
Superfamily Assignment

PSA tool

>gi|54296751|ref|YP_123120.1| MRDSLKMLLVGSISMIIIACAASPLSESTGEYLDSSTTTAKVKASLVDQLGTMGFAVKVK TYKDQVQLSGFVDSQKIKQRAGIIAAGVDGVKSVRNDLIIKTR
n-region:MRDSLK
h-region:MLLVGSISMI
c-region:IIAC
Superfamily Assignment

PSA tool

>gi|54296887|ref|YP_123256.1| MKKLLSASVITLMITGCAAIPADPQAERVIASPNPAPKGCKYVGQVVGNQGNFFTGGFTS NRNLEEGAMNDLKNKASKKGANYIQLVTNRAGVTGSMSGSFDRHGGFMSGGSEQTNVTNL GNAYICPPKAIGLE
n-region:MKK
h-region:LLSASVITLM
c-region:ITGC
Superfamily Assignment

PSA tool

>gi|54297019|ref|YP_123388.1| MVTINKRTLTMLCASLALSACSTANISQSAIPEQGLTVSQLYQQSMQQPVQKAVVQQVRF ENSGEEFKQLPNPEVPIHIFAHVAQLDDEQIIKPAYTTRFFLYKQNQYALASELY
n-region:MVTINKR
h-region:TLTMLCASLA
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54297100|ref|YP_123469.1| MTKTDKKIVVVTGCSKTSGVGYNLVCEMLKRGHQVIATVRNLETSQINKANLPNSSNLDV KILDLCDENSIDRFIKEVLSQYQYIDALVNNAANVAIGPVESTTTQDVLTTFQTKVFGPL SLIRGFIPVMRERKKGLLTTTSTIFTSVPVSIPGVAIYFSALAAFERLQESLAIELAPWN IKVINFQPGPIATELTRFEGSRSDIVEKYYKNFTEQAYQWFHQNTVFQNAAEVAKVFAEV IDMENPDLYYQSNLFGKQFVAKNKKDTTGREGMNELLEHFKNLSHDNPDDWKIQ
n-region:MTK
h-region:TDKKIVV
c-region:VTGC
Superfamily Assignment

PSA tool

>gi|54297143|ref|YP_123512.1| MKRIHVLFLIGLVVGISSCTKWGKDDEDNNPYKGMTAKQLYTAAQTSLKKEEYATAAKQL EAMESMYPFSDYTESSQMQLIYAYYKDEDYPSAAATAERFIHLYPRAKNVDYAYYMRGLA NFQQTRGVFAKMLPMDESWRDPGTQTQALVDFATLIQKFPDSKYKANALQRMIYLRNMFA QHELNVSLYYFKRKMYVAAIERASYLVKNYPQAPSAQKALVVMYEANKALGLNKAAEDAM AVYKATYHTSNMVRINS
n-region:MKR
h-region:IHVLFLIGLVVG
c-region:ISSC
Superfamily Assignment

PSA tool

>gi|54297199|ref|YP_123568.1| MNKYLVIILITLGLVSCQFKKDESYYRSHPSELQNALKLCPGTQPDGLSCQQLEAIGRRM NGLAYQLQYNPQEFGNKILALQQVIANQQREIQSKKDNAELQDSLKRNQEDLAYYLAVVK WLESPES
n-region:MNK
h-region:YLVIILITLG
c-region:LVSC
Superfamily Assignment

PSA tool

>gi|54297201|ref|YP_123570.1| MMRLFRKQLICIFFILSVAGCGTRSDLAPVTELKWQPYSKYQKFHTVRSGETLYAIAFRY DTDYRRLAIINHLRPPYSLRVGQVLSLKGIVPKSNHFHSAPRANLHITHKPKQKIIYSPA YNVRSSSGWLWPVTGRVVTTFIPSQGKKGINIACNRGDKVRASASGVVAYAGSGLPGYGN LIIIKHSNEYLTAYGNNARNLVTEGQRVSAGQVIAEAGLIDRSYWGVHFEIRRAGVPVNP LNYLQKG
n-region:MMRLFRK
h-region:QLICIFFILS
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|54297256|ref|YP_123625.1| MTQIHKYLASLILIWLLTGCGFHLRGAIDIPEWLDNVSIISRDGNKELVSILKSQLEGYK IDVNSDPSLAKYWLIINSSSLQQQIVSIGASTNPRQYQLILTIEFMLQTPKGQIIKTPRK VNVSRQLTVNNDRILGSNEEQALLVSEMRRDAAIQIINRLNRP
n-region:MTQIHK
h-region:YLASLILIWL
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54297320|ref|YP_123689.1| MKIRFTLLCFSIFLTGCVSKPPADINNICNIFKQYPKWYVDSKDVERRWKVPVPVQMAII HQESKFNARARPPRTKLLWIIPWTRPSTAYGYTQALRSTWDNYKRTNGWFWSSRDDFGDG VDFIGWYANQANIKAGIPRTDAYSLYLAYHEGIGGYQRKTYLKKPWLISVARKVKAKSQL YAMQLNSCQGSLKSRSWW
n-region:MKIR
h-region:FTLLCFSIF
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|54297341|ref|YP_123710.1| MKTKIIFKSISSLLLGLLLVSCSNELPPGEYDANEIGKIKKVIPGVIISKRPVNLHRQNA DANLHVKGGADSNLIDGGYNRTHGVEYVIKLNSGTIISVVQAEDLKLKNKQKILVIYGRH TRVVADNGSDVY
n-region:MKTKIIFK
h-region:SISSLLLGLL
c-region:LVSC
Superfamily Assignment

PSA tool

>gi|54297398|ref|YP_123767.1| MITIRLAEMNEIQFLNQLISCSARELSQEDYTKEEIEGAIQYVFGVDLELILDKTYFVIE KDGQIAGCGGWSRRKTLFGGSQYKGREQGVYLDPQQDFAKIRAFFIHPKFARQGLGSSLL KHCEHEAFLQKFTRFEMMATLPGVKLYSAFGYHPTSNEVITLPNNVPLRFVRMTKG
n-region:MITIR
h-region:LAEMNEIQFLNQ
c-region:LISC
Superfamily Assignment

PSA tool

>gi|54297417|ref|YP_123786.1| MNTAFRLLFCLIILELSACATLKSKITHHKTLSQCQQTCFQQLNYCKQNCTDNCRDCSTK VDHFAKENYLEYLHEVKIQGGYITRGLQSYRDPLQCRKVTCNCSADFNACNQGCSGVIQK RLQPVPYCS
n-region:MNTAFR
h-region:LLFCLIILE
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54297420|ref|YP_123789.1| MRKLLIVFSIFLASCQTTHDKPDLTNKRRQTTHTKNSVYDRYKYKSNRYTIQQDGAPKQA KQVSFKEPVPVKEPLSRYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSS GEPYNMYVMTAAHKTLPLPTYVKVRNLENGKVAIVKVNDRGPFHANRVIDLSYAAALKLG VFPKGTAHVEIETLMGPAGQGHYYLQAGAFSSEVLAKRLKEKLIHITPSPVFIEHYKQHY IVRVGPFGNKSMADNLKIKLSNNGIKGSFSVLI
n-region:MRK
h-region:LLIVFSIF
c-region:LASC
Superfamily Assignment

PSA tool

>gi|54297747|ref|YP_124116.1| MRILSCLVLIISLVACSSKPAPNTLVIGTIAGPETELIETAKQVAEKEYGLSIKIVEFND YNLPNEALQDGSLDANVYQHLPYLKAAILSHGYDLQAIGRTFVYPMGIYSKKYKTLSELP ENGIIAVPNDPSNEMRAFLLLEKAHLITLKNTTNSGIQDIESNPKQFKFKEIDAAQLPRV LPDVDAAVINTTFALPAGLSPSKDALFTEGKDSPYANIIVIRRDTEKRPQLELFVKALNS EEVKEKAKKLFGEDAIPAW
n-region:MR
h-region:ILSCLVLIIS
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|54297758|ref|YP_124127.1| MRLILMFASIMGSVILASCASKGSNPIDPFEPFNRKVHNFNMAFDATVLRPPAKLYQAVV PKLVRKGVNNAFNNLDLFPTIASDILQAEGKWVIKDSWRLFINSTIGVAGLFDVAEKFGL PPHYNDLGLTLAKWGDKKSPYLVIPFLGPSTLRDGAGWLFQFALWSPYVYIDDAGLVYGL IGLRYIDLRTQFFDSEPLLNEALDKYTFIRDAYLQHRNYLIAGTEQDTGTSFVEDKKANK TAMQESTASNNQLGSDYVDE
n-region:MR
h-region:LILMFASIMGSVI
c-region:LASC
Superfamily Assignment

PSA tool

>gi|54297790|ref|YP_124159.1| MMGISIRYIILGISVMNISSCMVYEDTYTTRYQIYTYDYGQLYPQADYHARDYNYGNQSG QGVVVPDSYHVGEYHSPVSFKDRDRNWVNSQNPQGYTIQIADDEKASYVAQKLYKAPKND RMAQVKYYQNGKTHYKGLYGTYDSQEAAQKALESLPPEIKQGAGIKDWGSIQGNLNE
n-region:MMGISIR
h-region:YIILGISVMN
c-region:ISSC
Superfamily Assignment

PSA tool

>gi|54297971|ref|YP_124340.1| MKAGSFYKLGLLVASAVLVAACSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESY TTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVAL GERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
n-region:MKAGSFYK
h-region:LGLLVASAVL
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|54298061|ref|YP_124430.1| MPRNRMIKSEFWTSEQVISCSPMARLLFIGLWNFADDNGVHPASFVKIKAEVFPGDNIDI SEIKKWITELIQQCLLIEYVINEKTYWIVTGWKIHQKIDKPTYRYPMPYSDLKLIPISPE PDSTSERQKVVEDFTTIHRDINDLSAKSSDEIEKKKKRKKKEKYICEVKTSPAEVSKITY SASKEEVFRYWQETMNHPKAKLDKKRSSVIHKALQLGYSVSDLKQAIIGCAQTPFNMGQN DRQQIYDDISLILRDAEHIERFINNATNPLNEKQIYNTNNNLMSGVL
n-region:MPRNRMIK
h-region:SEFWTSEQ
c-region:VISC
Superfamily Assignment

PSA tool

>gi|54298296|ref|YP_124665.1| MKRTLLVIIPAFLVGCSYNAKLTPEGEKVTILQSGQLSKGCTFLGEVRAYDRNGMSQSYQ SHEHLIKDERNILRNEAALLGANTVLVSQHQQTYEGNPKNDFVADHWMVGRAYRCKIKQ
n-region:MKR
h-region:TLLVIIPAF
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|54298299|ref|YP_124668.1| MLKAFRMIAVLIGLIGGPFFLSSCDGAVKHGSQEVDGGYGGHSAGGHGGHGGAGH
n-region:MLKAFR
h-region:MIAVLIGLIGGPFF
c-region:LSSC
Superfamily Assignment

PSA tool

>gi|54298323|ref|YP_124692.1| MKKSAILFGLLMITSCYAWQAINMEQFIKESQAQITEESLKLQEKLDARLPVSSKATTGK VEKRTLTLVNFSNPVFIIGDDTDSYQWLQKNAKKLEEAQALGFVANINTSEHLQALQRLT KAPLLPANVDDLMELFQETHYPLAFFGEELWQ
n-region:MKK
h-region:SAILFGLLM
c-region:ITSC
Superfamily Assignment

PSA tool

>gi|54298332|ref|YP_124701.1| MAIYNKLHTILALGSVLVLSACASKTVGSTAIPEGGLTVSQLYQQSLGDAMPGWSVPKRQ AKIVNYSGYTRDASNEIQHLFKPLDNPQVPIYVFPHVAVIGDEQLLKPGYTTAFFLYKQN QFALASEHY
n-region:MAIYNK
h-region:LHTILALGSVLV
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|54298518|ref|YP_124887.1| MVYMLKILALLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFKDP TLTALIDNGYHNNLSLQMAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRVGGNQLQG LLPPDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIK IRTSEELIKVTKTNIQVQAMSLKIAKDRYYGGQTSLLDVEQAATELAETQSKLPQYVSDL QHQKDILAVLLGTTPDKVDDLLKKNKGIPKASAVVEVGIPKEVIARRPDVYQARMEAIAQ SAAIGAVKANLYPSLSLVGTFVFASNNIGNSTISDIFNWSNRNIVAGPSLTWPLLNYGQI TNAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKKANASAIESTRLA LVRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQIRGKNDIVS NQIKSEMAARTNWGSLLKQENHLPPDSNGQRMKQLYLPTW
n-region:MVYMLK
h-region:ILALLSCLI
c-region:LSSC
Superfamily Assignment

PSA tool

>gi|54298621|ref|YP_124990.1| MSPIRVDFYLLASSLPESRWLVACRLIEKAYIKGHTIFVFCDNQQQAEYLDELLWTFKDD SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE KEVSRLHYKEYRYKGCALHTHSIE
n-region:MSPIR
h-region:VDFYLLASSLPESRW
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|54298664|ref|YP_125033.1| MNNNKIVIMFIFSALLAGCAGTMKFKKPPINNPSDDATIKLAEAAVSVSDSMLEMAKVEK VITPPSKDNTLTIPNAYNLQARASVDWSGPIEELTARIAKAAHFRFRVLGKSPSVPVLIS ISTKDESLAEILRDIDYQAGIKASIHVYPNSQVVELRYAKIYS
n-region:MNNNK
h-region:IVIMFIFSAL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|54298665|ref|YP_125034.1| MRKFILSLSILLSALLVACSSRNHYGDTGSLAGLQAMADSKYTRAQKKQKMGKIREMALK ETALSVGAQAGLAWRAKIIDEQLNKQARNLDAIYDFNSLVLEHNILPPVLLEGRNTLNLA DAQSIRVSDRTYKVAKQAHFITTPPTWRQYLWMDYVKPEAPNVTLLPKTKAEKEIWCIYT ERGWKNGIDQANTILEENIARIKEDFGGMILYRKLLAMNMVSPPYVSHTDLGVTGDGSEI HIDDRVLRITALPELNVNSAEWRAAVAKDENALERFKNMEKLANQAKIVITNKSWQPIIA PVS
n-region:MRK
h-region:FILSLSILLSAL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|54298833|ref|YP_125202.1| MFIRNLQLFIVVASCILVLIGTDILLPSLPNIAHSLSVSSNEAKMLISIFMIGQFSTVLI WGVIADRLGRRKTLFLGMLIFFIGSIFSLKADSIQLLLACRFLQGTGAVVVPVAGWALVQ DLFPKDEGARIMTWIGTLTAVIPLFAPALGGQLDVLYGWRSNLYCIAFYSFILCVIMLFL PRTIPVQKTTTADIKETLSIYIRIIKNKTFISYIALFGLLNCGEWCFLTVAPFYYSHAHI AADTMGILLMITSMGFVCGSLLASRLFNRLGIDKIIALGIQLAVMSSLMLLIGEYFHWSK YQLYNAITIGVYILSSALLWGATTSRALQCFDDCRGSASAIRSLILLCFAAFGTYSGRLV NHNSLFPVGLFLLFMAFIAFIVFNNKELKTERHIEGIPI
n-region:MFIR
h-region:NLQLFIV
c-region:VASC
Superfamily Assignment

PSA tool

>gi|54298838|ref|YP_125207.1| MLKRCYLLILLMFVLASCAHHKPQTPPADVKKQGTSSTRQFRQVSSFNQIVVQGRLNVNL HTGYNKPEVMLRGDPRDLVQVRTIVKQNTLYVSLGQGYPDYGTVTVDIKTKFLNRFRYEG AGVVTGNNIRTSYLDLYLANEGTTRLAGNIGLQKLEAVGSGVTQINGVSSRNLQIVLKGD PKVLISGFVNLRQLDMYGKGTLSLYWIKSDTLTIRAKKAAKIQLAGIVNRLDVELWDFAQ FKGKYLRAQRSFVKTHDKSVAEISAVNHQSSLATDASDIYYYNLSKTRADFMAFNGSVLD MREWSQSDLKDFDRYNKQFP
n-region:MLKR
h-region:CYLLILLMFV
c-region:LASC
Superfamily Assignment

PSA tool

>gi|54298924|ref|YP_125293.1| MNNYLKIFSIVLLILMLVSCGSSDKPQTSLLKTYEVKPQPLHKTLHFTGTVQPIRESSLT SPMEAVVETMHFHYGQMVKKGEIVLTLNSNELQKQYNDTLTDYLKAKDSYSIAKAKFVGT EELWNAGLISKNNYLSEKSGLDTARVTLMQATRKLSEMLEKMDDKNTQNISNLSLADFDK VRKILTSNHNLIHLKAPSDGIMLYPPKSGEDKNNRVTVGSTIKSGQVIALIGDLKGISVE IDVPEIDIDKIRPGMQATISGVAFGRHQLKGKLVAVNAQASNTSTGGLPSFTAVVEVNSL TPEQQSWIKVGMSASIELNVESNNQLLIPISAVKREKGSSIVQVQLAKGKVEKRMITTGA AQADSVVVESGLKSGDVVVYD
n-region:MNNYLK
h-region:IFSIVLLILM
c-region:LVSC
Superfamily Assignment

PSA tool

>gi|54298954|ref|YP_125323.1| MINYKTIKWRYGLIALFALGVSGCYFDGTSPQERGYSYQENSMPSSGGQTTASNQSQPQQ KSYASKDTSQKSTPGPKRTAAPQLPVIQ
n-region:MINYKTIKWR
h-region:YGLIALFALG
c-region:VSGC
Superfamily Assignment

PSA tool

>gi|54298995|ref|YP_125364.1| MFKHGCFILIVLFLASCLSGCLGALWTGATLAYDRHNVYKKLDDYNLIKALNDVLAVNRT FKNSETVLDIAVFNRDILIAGHVPTQELYDELQLRLSKVKGYRRLFNRVIINKMPSNSIQ DSWITTKIRSQIFADSSIDPNAFKVVTSDRVVYLMGDVQTEQAEKVIEIARYTSGVQKVI KLMRYYTYQTSTNMA
n-region:MFK
h-region:HGCFILIVLFLASC
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|54298996|ref|YP_125365.1| MKMNLKFKSIIVMMIGALLTGCVAVVVAGAAAGMVYDRRSVTTMEADARLFHVIHKTIIK DPRFRHSRILVSSFNRVVLLVGQTPAASLRVLAERIAQNAPGVKRVYDEITVDNPIPLTQ RTKDSWITSQVRSNMLTKKGLESGSIRIVTENGVVYLMGIVSDEQALLAVDVARRVAGVR KVVKIFQYIR
n-region:MKMNLKFK
h-region:SIIVMMIGAL
c-region:LTGC


References

  • Madan Babu, M. and Sankaran, K. (2002) DOLOP - database of bacterial lipoproteins, Bioinformatics. 18:641-643. PDF
  • Madan Babu, M., Leena Priya, M., Tamil Selvan, A., Madera, M., Gough, J. and Sankaran, K. (2003) An updated version of DOLOP with functional assignments to predicted lipoproteins, Journal of Bacteriology, in press.

 

This website is Maintained by M. Madan Babu * and K. Sankaran #
* MRC-Laboratory of Molecular Biology, Cambridge - CB22QH, U.K
# Centre for Biotechnology, Anna University, Chennai - 600025, India

This site is dedicated to Prof. Henry. C. Wu
Last modified : 14th April 2005