56 predicted lipoproteins out of 3446 predicted ORFs for Geobacter sulfurreducens PCA


Functional assignment
Protein sequence
Signal peptide features
Superfamily Assignment

PSA tool

>gi|39995149|ref|NP_951100.1| MKVLFRLVVVALTVMVAVAGCSKKEEQKAGGDAGAQHGQAAKKESVVVVPDNVKGKWKSV KIAVTDKAANKESVYTINVGAELAIPESNLTIAVDNFLPHFTMDGTTLTSQSNEPKNPAA QIRILEGGKEVFKGWLFSLYPTTHAFNHPKYGFTLVDFIPAN
n-region:MKVLFR
h-region:LVVVALTVMVA
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|39995174|ref|NP_951125.1| MGRMIRLAEVLSVAGCSEATLWRWERAGLFPRRRRIGLRAVAWDSEEVEEWRRTRPLCST ATVGEVGEVRAAL
n-region:MGR
h-region:MIRLAEVLS
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|39995191|ref|NP_951142.1| MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDILATQQAFVELVKKVT PSVVNISTVSRRKIEQPFFEFSPFFNDFFDNRPRFRREQSLGSGFIINREGYIVTNDHVV RDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDSREELPVAVLADSDKLQVGQWAVAI GNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASINPGNSGGPLLNVHGEVIGINTA IVAAGQGIGFAIPVNMAKQIVTQLITKGKVTRGWLGVTIQPVTDDLAKEFGLKKAQGVLV SDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQRVVGDTAPGTKVPVVVFREGKEVQL SLATASSDSAQARQARPQGGAPDTLGLAVEELPREYRQEGFTGVLVVQVDDGSAAGEAGI REGDVIVAVNRRPVANLAEYDRVMREAARRGSVVLLVRRGEASIYFSLRLR
n-region:MFVRR
h-region:LLLISLVFVTT
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|39995268|ref|NP_951219.1| MGGNHRIVVKLVAGIALAAALAGCGRKGPLVPPESFVPASVSTLTVEQKDDAFYVSWPAP EKDEGGRPLKDLAGFRVYRRPVLPPGQDCEECPTAYTLIRTVDLEYPQDVRSYDGRYVLA DRGLTNGATYQYKVISFKKDGSESGASNRARRTMVAAPPAPRLAASSSATGVALQWEPSP PATGEPVGAYIYRRRGDDLASLVLLTPSPVTGTSYEDQRLERGVTYVYLVRQVVAVDGQL VEGAASNTVRGALTEPE
n-region:MGGNHRIVVK
h-region:LVAGIALAAA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39995293|ref|NP_951244.1| MKTRLSVISVTLILAAALAGCATSREMEQVQADQRLLDAKIEQALQEAQAAKAAADAAKL EAQDATTRAESAEKAAQERERLADEKAKKADAVFQKSMRK
n-region:MKTR
h-region:LSVISVTLILAAA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39995476|ref|NP_951427.1| MGLRTVLLFAAFLVLTGCTTMVPRERLPYPLTDDSFGDPVKVVTIPLPVIATSPNEGAIL GGLTAFLLHNARDEVNTLIAPQVNYNQNFGTTFSLYGAFFPLPERNWEFNLSKSTNVNED YEVRLRDKTFLSLNGKPLETNAFLYYFTDGSSRFYGFESGSLQQDETNYANREYGITMGV GYDLTDHLQLVLGERFRKVDIRPGAVSKVPYIRDRFTTAEVPGINGFTAHAQKIALIYNT LDDRTMPTGGLYARASIEGSAELLGSDAGYRHYEVELKGYFPLDTARYITVVRVAYNQTL GSEVPFLERSILGGETTLRGYGRNRFVDSSYLLCNLEERIRLFRWSVFDVNTDWEVAPFI DLGAVMESLDRAEAKSFEFNPGIGFRAVVRPNIVGRVDIGFGNEGPAVFVGLGYPF
n-region:MGLR
h-region:TVLLFAAFLV
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|39995489|ref|NP_951440.1| MRKITVLALVASMLTLAACSGKGVQELYDTAQFEEKQHNLEHATKLYEEIVAKHPQSELA ARAKERLEAIKAGK
n-region:MRK
h-region:ITVLALVASMLT
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|39995500|ref|NP_951451.1| MRMGRGVRAACGVVLLAAALTGCGHKADKAESKQPPVVTGVTLIPAAGEAIPDGAEVVGT VRAADAAVIAARLPATVTGVLVREGDRVGRGKLLVTLEAAESSAQASAAAAQVAEAERAL DEARARKRLADATYERYANLFKDEAVTRQEMDNRRADRDVAEQGVERATARLMASRESAR AAGVVAGYTRIVSPLAGVVTAKQVENGMTVFPGTPLMTIEGDGGRRLEASVPESLAGRVR LGQRVPVTIDGAGLSLEGRVVEIVPAADPASRTFTVKVDLAGEGIRSGMFGRAFIATGQR QGILVPKSAVMERGALSSVWTLDQGNVARLRLVKTGKPLGDRIEILSGLTAGERVISAGL EKVVEGAKIQ
n-region:MRMGRGVR
h-region:AACGVVLLAAA
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|39995535|ref|NP_951486.1| MTLIRLQSRMLIPSLALVVPLLAACTTVTEERGGPQAPGIGFEEAPAVVDRTDRQHAPPT PMVQPPPPQAPLPQPPEPPATPAVAVPASLRIGPEHKYVNVRRGSSPRTKVVAVLKGGTQ LELLGKEGSWLRVRWQHGGKTAEGWVYRKFVEGNGL
n-region:MTLIRLQSR
h-region:MLIPSLALVVPL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|39995536|ref|NP_951487.1| MKRHSALLPCWSVVACLCSCASSPEVRPPVEWGFEREAIHLSLTGDPRLNLYQNSPHALV ACIYQLRDPNAFNQLRNEPDGPARLLECSRFDQAVATARRVVIQPGQVLNDVLDRAEGAR YVGFAAGYYLLDKERSVRLYPIPISEETKGFVSRTKLVKPGRVDIRLHLGPQEIQDVKEE PRKP
n-region:MKR
h-region:HSALLPCWS
c-region:VVAC
Superfamily Assignment

PSA tool

>gi|39995599|ref|NP_951550.1| MTFAELKLAPHILKAVAACGYTEPTPVQAAAVPRALENVDLLATAQTGTGKTAAFVLPAL QRLSSPPQGPGRGPRVLVLTPTRELAQQVTDAVRTYGAFMRVRSGAILGGMPYHAQLRLL SAPVDFIVATPGRLVDLLDRRSLDLSRLELLVLDEADRMLDMGFSDDVDRIAAASPATRQ TLLFTATMDSAMARLAGRLLREPERIDIAGTKTTHEHIEQRLHVADDLHHKNRLLRHLIT DESLRRAIIFSATKRDAENLALELKAQGHSAAALHGDMPQNARNRTIAAMKQGRIRLLVA TDVAARGLDVTGISHVINFDLPKFAEDYVHRIGRTGRAGASGIAISFASLNEVNYLARIE RYIGQTLPEHHIPGLEPSRPLRRVSAGSGRKPGMGAGPARKGSSNRPSGAAPGRSGKSSD RTSWGSRRSKDPVVEYRTGRHGAGQPRRSS
n-region:MTFAELK
h-region:LAPHILKA
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|39995608|ref|NP_951559.1| MNVSRLCSLYPTLLIPLLFVAGCGLFASSTAPVSRSPESMAREAEEFQSSRRFEDAIAQW RKVKESYISPELITLAEIKIADAQFDSGNYIEAAASYEEFRKLHPNHEKSAYALYRQGLS YFNQIHGFDTDQTPVSNTVTIFESFLRLYPQSEHAEEVRNKLDAARQNQVQYEIYVGQFY YRTEKYTSAIKRLEDALKRYPRSPLHDETLYYLGKAYIKAGDKAGGREAFQRLFNEFRTS KYVDEARSFLDKNF
n-region:MNVSR
h-region:LCSLYPTLLIPLLF
c-region:VAGC
Superfamily Assignment

PSA tool

>gi|39995609|ref|NP_951560.1| MRRLAALLFLLSLAGCGSDRRAVEEVLRLREEALSRGDAALYASLLAPAYRQARPDLEQN LLISGPIGYRSLERRIRLDGTTAEVAGRYVMKANVKGRILELAGQETIVLHREKDGWKIA GGL
n-region:MRR
h-region:LAALLFLLS
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39995650|ref|NP_951601.1| MPIRLLFVLVIACTLAGCARQVISRESLLLAERSLSFAVVRENPNAYMGRHLLLGGAVAE TANRPDGAELEVVQFSLDSDDRPQEKHGSEGRFLARSREFLDPLIFSRGRLVTLVGTVTG VTERRLDGTSYRYPVIAIREMYVWRPEDPYAQPAVHFGIGVGVGF
n-region:MPIR
h-region:LLFVLVIACT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39995682|ref|NP_951633.1| MLAKGFWLVVSLVAACSLAVVAGVVNPAEKVNALWLVTAAACFYMVAYRFYGAFLAARVL SLDPALRTPARRLADGMDFHPTNRWVLFGHHFAAIAGAGPLIGPMLAAQFGYLPGFLWIL IGSVLVGAVHDMVILGASVRRNGRSLAQIAKDEIGPVGGLAASLAILFILIVALAGLGLA VVNSLAKSPWGTFTIFLTIPIALFMGLYLYKIRPGRVGEVSAIGFVLLLAAVFAGHYIPG SPIEPYFNLSKHGLVVAMAAYGFVASILPVWMLLCPRDYLSTYMKIGTVLLLACGVIFMA PTLQMPPVTRFVSGGGPIIPGTLFPFMFITIACGAISGFHSLISSGTTPKMITSEREIPM IGYGAMLAEGFVAVMALVAATILIPGDYFAINTKLSFDAIAALGFPVERVRELSALVGTD VAGRPGGAVSLAVGMASILSSLPGMAGLMPYWYNFALMFEALFILTTVDTGTRVARFLLQ ELGSRVYAPLGQPRWLPGIIATSLMVVVAWSYLIWSGNVSTIWPMFGVSNQLLAAIALGI GTTVLIKGGKVRYAWTTALPMAFMYVTTFAASWQLTGSFLRKAATAPTAAEALTFRINGG LVAVMAILAVVTLGDMLHKWYGYLTSTRPVVTSEVLEYEEAA
n-region:MLAK
h-region:GFWLVVSL
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|39995782|ref|NP_951733.1| MRKNMLMAVTMLVLALGALTLTGCNEQIFNVNDVASDPAAYTGTITIAGVMGGTSQADRT VFGIMDLKELACTTPGCNKIFIPIRANGTVPALGDEVRVTGSFRTEPGGLIFVAEKMKVV KNHKIGG
n-region:MRK
h-region:NMLMAVTMLVLALGALT
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|39995859|ref|NP_951810.1| MKRTRYLVGIILTAIALAGCGDDKNDTGTAGSEYVFPAGTATLAFTAMSTAQLSVPVSGI ELTLALPAGMGVTTTTGGTGQIVNSTLTPGSALSGTNLAYGNYSASTRKAYLSMATTSSS YRSGEFLRLACTVDTGTSITLSGLRALNTPVTLVRAVGYDALTNSTVDLTGKLAVTLDAV R
n-region:MKRTR
h-region:YLVGIILTAIA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39995879|ref|NP_951830.1| MESREHRAGRLLLIACAISFVCFFGSYMRIPIVPLFATSMGADAAQVGLINSAFMLMAGA LSIPSGLVSDRLGRRIPLLGGLLLLAGSSFLLYWSNSPLQMAGVYLLFGIGLSAFSPTLM SYVADVTPPEVLGQAYGWYTMALYGGMTLGPAAGGFLGTALGLRPVFLVSGGLILAMFVV ALFLLPATPRAASGAAPHRAILPTLRGLMGNRRLLACLAATMGTCFGFGMFVTFMPLYIR SQGMHSGHVGFVFAAQSLANAVSRLPSGKLSDRVADRSRLVAGGLAVFAVALAAFGLCRS VVPLMGVAALMGMSMGVAFTAVSALIADVVPREQRGLAMGCYNTCVYAGMMLCAAGMGPV IREEGFRTGFFLNGVVGLATLILFVALYRRPVSVVGPSA
n-region:MESR
h-region:EHRAGRLL
c-region:LIAC
Superfamily Assignment

PSA tool

>gi|39995938|ref|NP_951889.1| MNRITRIVLTVFTIALLSGCARSAELIRTAGIAERQDVFVTQAEGQPLPPGYAELRIVSL LKTHKPGLYSSADVHGTPGYKLLLNIGGQALELSGDPRPERKEPVGPRDPEAGDGMRYQF SRTLHVKAGTHRTVMAIPDDTIAVEKEITLADGSRNTLVLEPVYGKMPVRSRPWNYNVTD FNEGIRSLRVVFNGKEK
n-region:MNRITR
h-region:IVLTVFTIAL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|39996116|ref|NP_952067.1| MLKRLVILAVLSLSSLMLSGCLVGEGKYLKKVEEADNLSKELTTLQEKYSALSSENEGLK GALAKLKDEAAGLAQDKEKLTADNRELQQVLQAKSDSLSQNIVELRQKVSQLEAENARLK ADIASTQKAKEEQVREVSKTYEDLLDKMKGEIAQGQVTISELKGKLTVNMVDAILFDSGK AEVKPAGMDLLQKVVEILKDVKDKAIRIEGHTDNVQIVGNLAKRFPTNWELSSARAINVT RFLQSRGIDPAVLSAVAYGEYHPVAPNDTDEGKAKNRRIEIILVPKDAP
n-region:MLKR
h-region:LVILAVLSLSSLM
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|39996132|ref|NP_952083.1| MSAWRDLKVRTKIFVLVIAGCLGLVVLGSVALYNMRNLSGSVKEANIGMEHVAGLSGMKS DFLEMRLALVYMLALKDAEKIGGKEQDFLKAADRIKKTLDDLGKQELTDTEKKSLVEFRG GFESYVEKGTRLAELIKDATAKGDEVGRADAMTFATQSVAPLYDTPAKIIASMVQENIGE AHKMYEQDMASYRASFIMMVVIILGVIGVAAAAGLAIAGSISGPLNKVLDVLTRVAAGDL TARADVVSADEMGLLAREVNTTAAKINEIIGLVAHNASQVTAAATQLHATSTQMSTGAEE VAQQAATVATASEEMAATSAEIAHNCSLAAESSRHANDRAENGSDVVQETLTVMNRIAER VKDSARTVESLGERSDQIGEIIGTIQDIADQTNLLALNAAIEAARAGEQGRGFAVVADEV RALAERTTKATKEISQMIKAIQGETKGAVTSMEEGVKEVEKGTSDASKSGEALQAILEQI GGVTMQVSQIATAAEEQTATTGEINNNIQQITEVVQLTARGAEESAQAAEQLAKLAEELQ DLVYKFKLA
n-region:MSAWRDLKVR
h-region:TKIFVLV
c-region:IAGC
Superfamily Assignment

PSA tool

>gi|39996330|ref|NP_952281.1| MRGYGKAFVALSVSLVVGVSLLAGCAALKQDRPLLPVREYERMIVGRLDAEYVGTDNCVA RCHKHEKITDDFRHSVHGEQIRPETGLPLVNCESCHGPGSLAIEKVGEDVAYNDEHKVKC DTGKLLDIKNLHTPAQSLICLKCHTAASTPSLAHWNTGVHALNDVGCFDCHKLHQGSQQK VSREEMAEMCYSCHPQVKAEAQLFSHHPLRERKMACTDCHEPHGSTQEHLLRGNTVKEMC TRCHMDKQGPFAFEHGDVTENCSTCHTPHGSVSNHLLNAAMPFLCLQCHSGHFYTLDADP ATASQNRRLFANRCTDCHSQIHGTDMPSAEGRAWFLQ
n-region:MRGYGK
h-region:AFVALSVSLVVGVSL
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996357|ref|NP_952308.1| MKTNSWRILLILVSCVWLSQPLSAVAAPATFASATVKLHDLELLDQDGKSRRFQSDVIGD RLVAITFTYTTCTTICPILDSIFVTLQKKLGARMGKDFHLITMSIDPVNDIPKRLKAYSL KLGARPGWTFLTGSKVNMDKVLVGLDMYSPDIYNHPPSIIVGDGKTGAWQRFYGFPSADK ILSSLTELQKARHH
n-region:MK
h-region:TNSWRILLI
c-region:LVSC
Superfamily Assignment

PSA tool

>gi|39996500|ref|NP_952451.1| MHTLIRPILRSFLAIAACLALASHATAASRSYQRSVESYSMPDVTLINQDGKKVRFKELV ESNQPVVVDFIFGTCTTICPVLSATYTNLQTKLGPDLKKIHLVSVSIDPENDTPQVMRDY LARYRAKPGWDFLSGSRKDIDRVMNAFNSYFRNKMDHKPLTFIRSPVDGKWTRIYGLISN VELMNELTKAGLK
n-region:MHTLIR
h-region:PILRSFLA
c-region:IAAC
Superfamily Assignment

PSA tool

>gi|39996533|ref|NP_952484.1| MTFRWIGCLLALLLIVSCSGEDRARAPAVRGPGTPAYGDAIVVGTIGEPSNLLPLLASDS ASHEVAGNIFNGLVRYDKNLNLEGELAESWQVSPDGLTITFHLRKGVKWHDGVEFTSRDV LYTYRVTVDPKTPTAYAEDFKQVKTAEAPDPYTFRVTYAKPFAPALASWGMGILPAHLLE GKDITKSELSRRPVGTGPYRFKEWVAGQKIVLESNHDYYEGRPYIDRYIYRIIPDNSTMY LELKAGGVDLMGLSPVQYARQTDTPEFRSRFAKYRYPASAYTYLGYNLKNPLFADRRVRQ AIAHALSKDEIIHGVLLGLGQVAVGPFKPGTWAYNPTVRDPGYDPVRARQLLAEAGWRAT GPDGILMKDGKPLSFTILTNQGNDQRLKTAQIIQRRLRKVGIDVKIRVLEWASLLTNFID KRNFDALIMGWTIPQDPDLFDVWHSSKTGPKELNFVGFKNDEVDRLIEEGRRTFDQEKRR RCYWRIQEILAEEQPYTFLYVPDALPAVSARFRGIEPAPAGIMYNFIRWYVPKEEQVH
n-region:MTFR
h-region:WIGCLLALLL
c-region:IVSC
Superfamily Assignment

PSA tool

>gi|39996537|ref|NP_952488.1| MKLAKWLLGPLAALGILAGCATSMTDIKGFNMISIEQEKELGNKFAVEIEKQQQPVNDPE VQRYVDKVGKRLLSGARAVEFDYVFKVVKDDSVNAFAIPGGRVYVHTGLLKAADNETELA GVLAHEINHAVARHGTRQMTQEYGYSLVLSLVLGDNPNMLAQLAGQLFGKAGMMSYSREY ENQADFLGVETMYKAGYNPNGLTSFFQKLNAMDGGTQSNVARFFSTHPLTSERIQRVQAE IAKLPPQRYLTDETEFKKIKGRLK
n-region:MKLAK
h-region:WLLGPLAALGI
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996564|ref|NP_952515.1| MKVRAGISALVTIAVLAGCASHLPVYRIDALARLSAVKMMGAEKYAPPELASLQQAIVDG DALMQSGEHELADSYYLLAIRKSEAVERSIAREREHERAMQVRSENERLARERQKALEEL KRELAEKEKEEKKRIERAPQPVRDKEKEKEVRSFPLHHTVKRGESLPQIAAQPDVYGDAA LWPLLYRANRDQIRDPGRIWPGQVLRIPRNISRDDLAEARRYAQERPAP
n-region:MKVR
h-region:AGISALVTIAV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996577|ref|NP_952528.1| MKRLVMVVTALLGLSLLSGCGYNVMQANEEAVFSAWGDVEAAYQRRADLIPNLVEVVKGY AKHEAETLTAVTEARAKVGSMQVTRDAVNNPETLAKFQQAQGELSSALSRLMVVVERYPD LKANQNFLDLQNQLEGTENRINVARTRYNKAVQDFNTSIRTFPNSLTNKLLLHLERKEPF KADEGAKAAPKVKF
n-region:MKR
h-region:LVMVVTALLGLSL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|39996640|ref|NP_952591.1| MNRYFFRMCCSLFICMLVSSCGGQNEGNQQPRNTQLQFSAGIGYPVPATAFTNAFGDIAT GDLNGDGRNDVAVIEANGSKGILIYCQNAMGALNEPLIIDSSLQLSGITVGDVNNDGLSD LVVSGDVPGLPELRGRTKVYIQNRSTHALDPDQEYALSTDTAGTLAIADLNSDGRKDIVV ASVQGSNGLLSIFFQETGGLGAEQTYTSVPVVYGGEVHVADMNNDGRNDIIVQSDLKQLA VIKQSSPGIFNATPDYYTVQTSYWPDFRSFAVGDINGDGLADIVAADPASNGLNIFVQNS TGSITGPQILQLTPLTAQDEIKIADMNWDSLNDIVILSEHSKVQILPQTANHSFDTFKSF DLQTQFSGGTFTHQAMALIDVTSDGMPDVIATLSGGGLFVLPTK
n-region:MNRYFFR
h-region:MCCSLFICML
c-region:VSSC
Superfamily Assignment

PSA tool

>gi|39996745|ref|NP_952696.1| MTTTRSLPFLLIVLALAGCGDFEWFPDTETNQGSLGTVADAERNAPVVSKAFTITGGSAA ISIANGEYSIDGAPYTSASGNVQTGQSVTVRHITSNAYSSSMTTVLTIANESIPFTSVTM SKPPVFVNSSTATDFTFAPKLDVEPNTVIVSDSRTITGNTSPAPISITDGEYSTNGTDFT SSAGTINAGQSLHVRHTSPTTYQTIKTTRLTVGGVRTNFSSMTKAAPFVNYSTVSPVNAD PTNVISVAQPLAATKDFTTSTHVSFSIRYFLNNSSNEQKNIGLTIAGADAQNRRIYYGTI DAAVPANANPYTSTHSFGAALTIAQYNSITQWLVTKIIIYQ
n-region:MTTTR
h-region:SLPFLLIVLA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996766|ref|NP_952717.1| MIEIDAGRCKGCGRCVAACSSRLLSLEVKDGKKTVVLDYSERCSACGRCVTECPFEAIRG GTVGMPGEQNKRAEGG
n-region:MIEIDAGR
h-region:CKGCGRC
c-region:VAAC
Superfamily Assignment

PSA tool

>gi|39996842|ref|NP_952793.1| MKAHVYALLITIVFLAGCSGIKVVPLQVPQGVVNLSDNSQTVTKDGVSITVANSNTEMVS YNLDGTVTAFVVTIDNQSSREIGFDTGSFLLLDGENRQYLPLTPEQVKELMSRDSYYLIP YPYVGFYYLEDYERTSFYNTTESQLPYYYEVYPQDIQTRALAANPVIPGAKSTGLVYFRI DLGAVKEVKLLIYRSGSSKSVAPDFLFPFAVGK
n-region:MK
h-region:AHVYALLITIVF
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996877|ref|NP_952828.1| MRTIANMAIAAVVLTFLAGCTAGLTAFNKAEKLEEEGKLDEAVMKFAEAASTNPQQTEYR MRLLKASEKAAFEHLKNGDTAYEQQLLDEALREYQSAVSLNPALARAKQRSDELIRVRNS LTYYREGLEFEKSNKPREALQAYRKALDLNPGNKEIKEALEKLLQTRRTKLEGFELNLKS TKPITLKFKEAKLKDVFYILSQLSGINFIFDEGVKEQNVTVFLENATFNQALDLLTSMNK LGRKVLNESTILIFPKTPEKAKQYEDLMVKTFYLNSLDAKKAVNLLRTMLQVKKIYVNEE LNALVIRDNPELIDVAGKILEANDVPDAEVLLEVEVIQVSKNNSELFGLGLSRYAVSLNA RTPGSGGDFFSDTFDPKVTTTSNDTTTVTTTQVKNLLNLFNWNGYQGFLTVPSATYNFSK QLSNAEVLSNPKIRVKNREKSKFTVGTRVPITTTSSTGSVGGVTVNVQYVDVGVKLNAEP VIQLNNEVTIKLGVEVSSIIGEKTVGSGDAISSVVTIGTRNVDTVLNLKDGETSIIGGLI EDTKSKSKQKIWLLGDIPLIGSLLSSHNDRYDKSELVLAITPRIVRAVSVPEADVAAFWS GKEDDPTAVKPFSSFELEPDFAAQPAGAPAKGAPAVPSAKPGSAAPAGQPATAADAPAAV VQPAATPAAASAAGVQASVAPVQPAMRGSLNIAAPAGVDLGGQFKVEVKVTDVKGLAKAP FTLLYDPIFIEYVGAAEGNFLNRDGKPTIFNALADKAAGRVVITMDRSAAGEGVDGSGTL LSATFKAKNKGPASLGLQNVKFVDQANRPLDIIPYNTVVEVK
n-region:MR
h-region:TIANMAIAAVVLTF
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39996887|ref|NP_952838.1| MRLSRGVFLLLLLLALASPLMIVGCGGPSFLPAASLRDPSVDMAWPPAPNPARIRFLREI SGPEQVKAEPGAIARFLEFVTGEQFKHVPFVTPYGVVSDGGTLLFVSDSSSGVVHRIDLA RQKVSYIVRAGDEFLSSPVGLALSPSGDLYVSDSVNAKVYVFSRDGEFLRVLADGQVDFK RPAGLAVNSKGVLFVVDVLAHKLKVFNVSGRFLGDFPPDDIGGKLNLPSHVAVDKDDKVY VTDALNFTVKVYDSARRYLRSIGEIGDAPGSFARPRGVAVDSDLNVYVIDAAFDNFQIFN QEGQLLLFVGKPGKKSGEFYMPSGIHIDRNDRIFISDSYNRRVQVFEYLKEENR
n-region:MRLSR
h-region:GVFLLLLLLALASPLM
c-region:IVGC
Superfamily Assignment

PSA tool

>gi|39996916|ref|NP_952867.1| MNRSFRLVMMVLACVVLAACTRVLSDEARRLVDPTVTFTGLKANPDAFLGKYVMLGGVIV DTKNNSDGGQIEVMQVGLDESGIPGDTFRSEGRFLATSAQFLDAVIFKPGRLVTLVGEIK GKKVQPLDEVNYSYPVVAIKEIHVWKSQDYDSGYPYPTPAPYYYYDPYWYGVWPGPYWHR PLGPVYRRW
n-region:MNRSFR
h-region:LVMMVLACVV
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|39997146|ref|NP_953097.1| MLRLVVLLVALVACGMIVGSPVRAADLKITEMAVTTKISRNNPIDAVRRISHRSVKALYC FTRIVNPGAQETVIRHVWYKDGTMASEQELTVKGEKWRTWSKKPVDAESVGSWRVEAVDS TGKVLKAVEFKVH
n-region:MLR
h-region:LVVLLVA
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|39997195|ref|NP_953146.1| MRVVITGKGGVGKTTLTSCLATVLAGAGTHVLAVDEDPQMNLPNALGVPYEEAAGIVPLN RHADYIEEKTGIRPGRNGWGALFKLNPDVDDVVSRLGLKVAENLSLLVMGTVKQAGGGCL CAENVLLDATIRHLALRMNEAILLDTQAGMEHFGRSLAKGFGQCVVVADSSFNALSVALQ SAALARESGIGLVHLAVNRVTGDDLRLERFQRETGQSLPDIFDRVVQLPAEPLLQTLDPH VARIMADRHSGYAAAVTRLASVLCSPPCPCASPRDHARHHHHAH
n-region:MRVVITGK
h-region:GGVGKTT
c-region:LTSC
Superfamily Assignment

PSA tool

>gi|39997231|ref|NP_953182.1| MKRLCLLVMAISLLSGCAESSALIKANSVSLRTDVFEELTNGVTAPQGDVDVRLTATFKT HKPGIYSAKDIHGTPDYKLLLNIDGQAVLLQGSLQKENNEPMKLVDPEAGDGIRYRFSKN LRLKAGIHKIVVALPDDEVAIAREITLNEGDRNSLVVEPIYSTKPGKRRPGMYSTTSFTE GIRSLRVMLNGKEV
n-region:MKR
h-region:LCLLVMAISL
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|39997370|ref|NP_953321.1| MKNIINFRMAAVLASCTLLSACADGDLPYSDSTSISSPAYSHSAVFQNMTTLAVWGNNES GQLGDGTTTSAATPKRLRLGFATYSSGFATGASHTLAIARFDNVSGVRAWGSNSAGQIGR DPATVPTSSTPVKIGGFGGAVQQVAAGGLHSMALAGGTVWAWGSNSAGQLALNPISSATR FAPRQVETAKLPIAPTAIVAGGSHSIAYTSTEAYAWGNNASGQLGNGTTLSNHMPQKVQL PSSITIRKISAGGSHNLALDSTGAIWAWGSNAYGQLGNGTTTNQSTPVQLTLPAGVTGFI DVFAGPSHSVAVASNFTVYTWGFNTLGLLSVGTTGDQLSPAQVRDASNVPFTDVERVVLL GSFFTIVKKNGSGGMWAWGYNGYGQLGDGTTSNRTAPVQVALP
n-region:MKNIINFR
h-region:MAAVLASCTL
c-region:LSAC
Superfamily Assignment

PSA tool

>gi|39997469|ref|NP_953420.1| MKQVLFAAFILLFLSGCSLFLSEPRVAVKDVAVTGFGADGVDIELLLGVTNENSFALSLT GYSYDLQVLALPLTTGGDRRRIEFPGGATTDVRLPFRVPFRSVMEILKRHPDPAAIPYRL TGSLEVETPLGLTLVPVSSTGTFSVPQRYRPAEILKGFTEVINGLRR
n-region:MK
h-region:QVLFAAFILLF
c-region:LSGC
Superfamily Assignment

PSA tool

>gi|39997727|ref|NP_953678.1| MKSGFIAAFTLAAFTITSLTGCVTVSEEHKGAAKGAGYGAAAGAIAGAVLAGEGSRTKGA VLGGLAGALIGGLIGNYTIDRKYTAEQTATRYNYQPASGTMVRIENITTTPTSVNAGEKV EIQTTYALLTPSATAQTNVTESVEIRYGGDLVGNPEATVAHTGGTYTSTIPIILPADAKK GSYKVIATVKTDSGKDTRETSFTVR
n-region:MK
h-region:SGFIAAFTLAAFTITS
c-region:LTGC
Superfamily Assignment

PSA tool

>gi|39997736|ref|NP_953687.1| MKRLIALAGLVTLTLAGCGGGSNAGNASSPVATSAHTPIWVTYHRFPTTESFSNNGAEAL NQCKVCHGTNLLGAAEGAGAPACLSCHVVDPVPYPERCYSCHGSDPVKPFFSWYSTMRST RNGMPIDPAFVQRVRNGSLRHLKHDAVPPAEMENPDACLRCHAPQTEFPDRPLPEIHHKL VFTVRDITGDGIPELVDCTSCHVYTIDPELNIPIRAVRDCVLCHPTIVR
n-region:MKR
h-region:LIALAGLVTLT
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39997759|ref|NP_953710.1| MTVKWLVCVLGGVLLAGGLAGCSKDGEAQNARVEKPALAVETVPVTARDLAEGIEVTGSL EPKFSADVKTQIPGLVKQVYVTEWVRVRKGAPLARIDTAEPEALTKRAEASVESARAALA QAQVSANRAERELARIIKLKESGLATQQSVDDARTESAAAQARIDAAQAQIRVTQEELRQ ARARLAKGLVVSPLDGVVALRDVNVGDLAGDAATGKPIFRIVDNRVLNLTVTIPSADSAR VKVGQPLEFSVDALPGRIFTGTVMFINPELSAEDRSLRVIAEVRNDGELLKGGLFAKGRI LVGRRPAVVQVPRGSLAAWDTASKKASIFVVAGNVAKMKQVETGVVIGDGVEIVKGVGPG EQLVTRGGFNLKDGDVVTVVGKGAAQ
n-region:MTVK
h-region:WLVCVLGGVLLAGG
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39997785|ref|NP_953736.1| MKRFIVLFFLAACFPLAPNAAAAPQSYFYPFVNPYEATVMELPRNFEVRLPEKVPSREFT LKVFPAREIPPAFWYEDGLVCTLAYQNHRAPLVFIIAGTGASHNTPRMVKLRSALYQGGF HVISLTSPTHMDFVVNASSGLPGDPLDDARDLYRVMEMAYDAVRDTIDVSGFDLAGYSLG AFNAAFVARLDEEEKRFNFSKVLLINPPVSLYESVAALDQLLVENVPQGMEQFDAWFRSV FAEFSHVSREVGPGSLSGDFIYSAYKRFPPNEENLAALIGLSFRMSAANMIFTADVMNGG GYIVPRNARLTATSSLTRYATVSLHTRFTDYFDEWFFPNRRHREPSLTRQALLARMSLRS QEAYLRNADKVGLIHNEDDIILAPGDIDYLQGVFGGRARLFPTGGHMGNMFHPDVVSFMI DFLAGKER
n-region:MK
h-region:RFIVLFF
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|39997819|ref|NP_953770.1| MKPIQLFIVAVAVTGALTLTACTHMLSKESSLPSWHPESLATGRVDCTECHEDRARGVLK PYAAFSHTPVFVRDHRYYAGQDDRLCASCHKRSFCYDCHANELEIKPSVMHGDRPDRQLV HRGDYLTRHQIDGRIDPTSCFRCHGRTNNEQCVACHR
n-region:MK
h-region:PIQLFIVAVAVTGALT
c-region:LTAC
Superfamily Assignment

PSA tool

>gi|39997825|ref|NP_953776.1| MSRKVTKYSAVLAVSLFAAALAGCGSENKEGTVGTGPGGVATVGDTACVQCHSAVVDPLT GESIITQYTRSFHYSKGVGCEGCHGGGAQHNGVGPLPFPLAGQSEAQIAARCASCHNGVI APLSSSPNFVNGNHANPFGGEEAKENLCSRCHSHEGAIFGAQAGFTGDGNILRNAAYQPV YPQDPETFNVMTCATCHQHGGAQRQVFTQISTAGVPNSRRTVAWDPNRNSINDQYDLCTS CHTVNTMTGTLIGSGNVLQIFTSNAVGSGTKSVTTAPFYHNTRWFRTLPSTHYDFPESKT TASGTTIEGYVIRRNTANPCFDCHGHEFQTNTRRLAGADRPNTIFLDWGQSAHGGKLLQA KVAAAALASSGAAEVDDVMKAGATDATAPGWTHYNWDDTASRGACQRCHTSTGASNFLNN PAGYDRTGAGNSFTHLAGWTSSNKRSDQNELLYCWGCHTKAGTGELRNPGAITEVYPGIN STSTGTTGLDVTVSYPDIKGSNVCMGCHLGREVGDNIKAITDADGILGFVNSHYLTAGGQ LFGTTGYEYATRSYANPAFFQHDKIGTAAAPGTGTNGPCAGCHMTTPTSHLFLPVTKDGT GAITAITSTACVTCHAGTFALTPEGLTAEEEEYVASLEALKAALAGKGILFFNAHPYFYR DTNANGIADPGETVSSNAFTNWAGVYGLALWQDVMGAAFNANLLIHDPGGYAHNRFYSKR LIWDSIDFIFDGVLNNDVTAAIDAQVTAARLDSATATAAKAYLGATRP
n-region:MSRKVTK
h-region:YSAVLAVSLFAAA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39997831|ref|NP_953782.1| MSRKVTKYSAVLAVSLFAAALAGCGSENKEGTVGTGPGGVATVGDSACVQCHSAVTEALT GESLIAQYQKSSPHNTAGLGCESCHGGGAQHNGVGPIPFAQPDASRCADCHDGTTAVATN SDTAFAESRHNIQTIRSGATCRRCHTHEGAVLSNIAGYTGDLATLEDTVNQNKVPLVSSY SQISCATCHEHGGGLRTIKATNGAAGPVVNWDPNNNRTVDQFDLCTSCHNMYSYNGSTLL TNGVPVNGVATGTVGHHETTWYRIIATTHFDNYSTGPQAGAGASGTNAKVEGYVLRRTGA NPCFDCHGHEAKTNTRPGRDATIHTDWAKSAHAGGLLTAKYNAVGALTGAAAVNAAMNAY VDDTTAIAWTHYNWDASSRGSCQRCHTATGAANFMSNPAGYDPTGAGNSFSHLQGWSAAN GSKQNELLYCWGCHTNAGTGELRNPGAITENYAGVNSTSTGTTGTAVTISYPDIAGSNVC MTCHLGREAGENIKAITDADGILGFVNSHYLAAGGQLFGKTGYEYATRSYAKPTFFAHDK IGTAAAPGTGTNGPCAGCHMTTPNSHSFLPVTKDGTGAVTAITSTACATCHAGAYALTPE ALTAEEEEYVASLEALKAALAGKGILFFNAHPYFYRDTNANGIGDPGELVSSNAFTNWAG VYGLALWKDVMGAAFNANLLIHDPGGYAHNRFYVKRLIWDSIDFIYDGVLNNDVTAAIDA QVTATRLDSATATAAKAYLGTTRP
n-region:MSRKVTK
h-region:YSAVLAVSLFAAA
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39998064|ref|NP_954015.1| MNVRRNLSLLLLALVLAGCRNPYLIAQRFEDSSREHNRLMRWQGLEQSCVIFAGEQVKDV CLERARAAKDVSVADYRVTSTELDVNKGTATVRVEVDYFILPSTRLKTLVDEQQWRYVED EEKGSRWLLVTPPPEFR
n-region:MNVRR
h-region:NLSLLLLALV
c-region:LAGC
Superfamily Assignment

PSA tool

>gi|39998077|ref|NP_954028.1| MMGSVRILALGVLCALAIVLVGCSKKDEGRTPAAHAGMSVVTTLFPLYDFARNVAGDRAE VTLLLPPGMEPHSFEPRPEDIVRVSRASLFVYTNRAMEPWAADILKGVGGGGPTVVDASR GARLLAAAGIHEHGDHHNEGDHHDGPHDETRMDPHLWLDFANAQRMVDNIAAGMAERDPA NREAYLANAAAYKAKLAHLDERYRQGLASCSSRTVVHGGHFAFGYLAARYGLRYEAAFAA SADAEPTPAKLAALVKRIRTEGVRTIYTEELIDPRTAETIARETGAAILPLNGAHTVSRD DLARGVTFISLMEKNLENLRKGLQCR
n-region:MMGSVR
h-region:ILALGVLCALAIV
c-region:LVGC
Superfamily Assignment

PSA tool

>gi|39998141|ref|NP_954092.1| MNGKQLAKGWSVMRAAAMALIACMMCIGVAFATTGTQVVKEAGIRAVVAEYVRERTAGLG VETEIRKMAPIGDLKLPAGTVSYEVQAPRSWEGWGRANLALIVRVDDRVQRNIPVTVDVE ALADAVVAAHPLARGDIITSDDVTVQKRDISSVNGRVYRSIDEVVGKRVKNAVRANTPLS GASIEKVPLVKSGQLVTIIAESPALRLTATGKARGNGAEGDIIKVQNMGSLKEIPARVID VGTVQVDF
n-region:MNGKQLAK
h-region:GWSVMRAAAMA
c-region:LIAC
Superfamily Assignment

PSA tool

>gi|39998220|ref|NP_954171.1| MIRKLFAGTLMGLCGLLAACAIITVNVYFPEKAVKEAYKSLDDMLLGREGEQKPAPDQKP AEGQPPADKPQSRLWNSLPSLSLVTEAWAADDYADQLAVELSSMPEVLKAYDEMRARLPK LDQLRSQGVVGETNQGLVTMRDAAKAAPGDDAVVKAENDNRKTVITGMARAIIRLNKQKE SKQALSQVLPKAAATYADTRREEARPGWWIQLQNGRWVQK
n-region:MIRK
h-region:LFAGTLMGLCGL
c-region:LAAC
Superfamily Assignment

PSA tool

>gi|39998230|ref|NP_954181.1| MKPYIALSAILVAMLLVACSARGEVRVVRQEIAVRLVPPQHLVVGESTLYLAPGAAGEFS LALNGAARLEAVRLDGRDIPFRREGGTLRLNLSAGTGERRVTVAYRCIFNDPAPERPVVT EDPSYGVNAVVAERGTYLGSGAGWYPEPAAPPGRRIVTVEAPAGIEAVTAGRRAVRETAG GVTTSVWEEEHPAEALSLSAGSYVVAERNVDGIPLYTYLYPENAVLADRYLEASAGYLRF YAEKFGPYPFEKFAVVENFFPTGYGFPSYTLIGGTVIRLPFIVHTSLPHEIAHCWWGNGV LVAYEKGNWSEGLVTYLADYLLEERKSARDGRDYRYRLLADYASLVSPGEDFPLRRFMGR VDPASRTIGYGKGSMLFHMVRREIGDDAFFGALRQVFREFRFKAASWDDFALAFSRASGR DMVSFMNPWLERTGGPRLALTDVERRQGGDGWLVSGVVRQVGDAFPGRVRVRVDAGGTSR DILVEPTRGRTAFTVDVSGPPERVTLDPEADTFRLLSPEELPATVNRIKGSMALTVVTSP GCGADRDTLALLLRSLGQAEAPLIRQDQLNAAALAGRDILFCGVPGTTGIRSPLPHGVSA SAGTFVVDGTTYAGAGDMLFAVANRPDAPGRVTAFLHSLSPAAAGAAALKITHYGRYGVL VFSGGDNRVKETPPALSETSVVTFDRQVDR
n-region:MK
h-region:PYIALSAILVAML
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|39998426|ref|NP_954377.1| MVTFAGTLRIRAVLLLVVACSWLFFGCTPRPAVSVSPDFRPTGGVETAYVVPFASALVPE LFSETAFNDFVDLLNGRRGETGIASFVILKEEVKEVDPTWLDRQHYISGDIWSYVEDSGC CATSIRVKARAYLHEPGRKDPVAEIFVPLEAFFDHDRSTVERERDRLARTLARELADRFA VILAPRR
n-region:MVTFAGTLR
h-region:IRAVLLL
c-region:VVAC
Superfamily Assignment

PSA tool

>gi|39998488|ref|NP_954439.1| MIRTITYGILALLAMTLLVACSKGNGSREAGGEAGHGPVQMTAWSDRTEVFLEHPELEPG KGATLLIYLTRTADWKPLASSEVHLVITPPAGTPLTVAAKGTKPGLYRAEATFPAKGAYR LTVVIGGSQGEQIELPSLLVGEGHDHGEGEHKETAASDRKEGTPHDRDDHGDHAAETKQG GGKEPAHAEHDDHDEHAGHGGHDSHDDHEGEQAHDETGKAHAHAASGAVGAITLTKEQQW AVAFGVAEPRRMDMASGLTAVGELVPVATAEAVVAAPLAGVVSPTRALPFPGKRVAKGEV IAVIDPPASLGGGMTQLAADHAQAMSRLTLAQAEYDRAKRLVEGKIAARKRLEEAEASLE AARAVATPLETAMKSVQGGSGGRITVRAPVSGTVVEVPAVNGSGVAPGQTLVRIVDTGRL WLRVNLPATDLGKVGRPAAAGTTFTVTGLPGEFHTSGLVSDGTVVDPQTRTLPLVFAVEN RSGNLKAGMFARVTIRTGTAKGVLAVPKEALFEDEGRWFAFVQISGITFDRREVQIGTED QGMIQIVSGLDEHDRLVVKGGYYVKLASQGGATADPHAGHGH
n-region:MIR
h-region:TITYGILALLAMTL
c-region:LVAC
Superfamily Assignment

PSA tool

>gi|39998516|ref|NP_954467.1| MQTFVKALISLTIIIACARIGKRFPTLGGLIATMPLTSLLVLLWLWSESPGDYRLMEGYT RGVLWGIIPTILFFVVAYVLFRRHLPLPVVLAASFGVWLAGAAVHQYFLK
n-region:MQTFVK
h-region:ALISLTI
c-region:IIAC
Superfamily Assignment

PSA tool

>gi|39998551|ref|NP_954502.1| MKIRILKIIAAVLLPTLILTACTSYRSQYVGFRPAEDYINSQVVNGVTIGGEAFADTASA TDAFGFDVIGTGVMPVQVVMSNKGPRSLEIVSSQTFLVNDQNRYFPVIPNTTAVDRIEKS TQFASFFGKGAGKGALLGAAGGAILGAAIGIVSGHSVAEAVGKGAAVGAAGGAIAGGVSE GTSGERERTIIEDIRNKGLEGKALPADSIASGFLFFPAEAGSAKELRLQLRERETGVTSN VVLRFK
n-region:MKIRILK
h-region:IIAAVLLPTLI
c-region:LTAC


References

  • Madan Babu, M. and Sankaran, K. (2002) DOLOP - database of bacterial lipoproteins, Bioinformatics. 18:641-643. PDF
  • Madan Babu, M., Leena Priya, M., Tamil Selvan, A., Madera, M., Gough, J. and Sankaran, K. (2003) An updated version of DOLOP with functional assignments to predicted lipoproteins, Journal of Bacteriology, in press.

 

This website is Maintained by M. Madan Babu * and K. Sankaran #
* MRC-Laboratory of Molecular Biology, Cambridge - CB22QH, U.K
# Centre for Biotechnology, Anna University, Chennai - 600025, India

This site is dedicated to Prof. Henry. C. Wu
Last modified : 14th April 2005