Methylmalonyl CoA Mutase

PDB code: 4req
E.C. Number: 5.4.99.2
Oligomeric unit: heterodimer
No of residues: 637
Topology diagram:


PDB
SCOP
CATH
IBM-JENA
MMDB
FSSP
Relibase


Ramachandran Phi Psi values:

Global summary of  BLAST search:

QUERY= Submission, 637 bases, 13EB3FF8 checksum. 

                        |=================================================|637
>MUTA_PROFR       3027  1 ------------------------------------------------- (MUTA)METHYLMALONYL-COA MUTASE SMALL SUBUNIT (EC 5.4.99.2) (MCB-BETA).[Propionibacterium freudenreichii shermanii]
>MUTA_STRCM      46708823  1  -----------------------------------------------  (MUTA)METHYLMALONYL-COA MUTASE SMALL SUBUNIT (EC 5.4.99.2) (MCM-BETA).[Streptomyces cinnamonensis]
>Q9F165          249897632  1  ------------------------------------------------ (MCMA)METHYLMALONYL-COA MUTASE SMALL SUBUNIT (EC 5.4.99.2).[Amycolatopsis mediterranei]
>MUTA_MYCTU      1539528431  1   ----------------------------------------------  (MUTA..)PROBABLE METHYLMALONYL-COA MUTASE SMALL SUBUNIT (EC 5.4.99.2) (MCM).[Mycobacterium tuberculosis]
>Q9CBM6          968767564  1   ----------------------------------------------  (MUTA..)METHYLMALONYL-COA MUTASE,.[Mycobacterium leprae]
>Q9K8P7          32447724  1  ------------------------------------             (MUTB)METHYLMALONYL-COA MUTASE BETA SUBUNIT (EC 5.4.99.2).[Bacillus halodurans]
>MUTA_PORGI      1017891035  1  -------------------------------------------      (MUTA..)METHYLMALONYL-COA MUTASE SMALL SUBUNIT (EC 5.4.99.2) (MCM-BETA).[Porphyromonas gingivalis]
>Q9GK13          -1257242042  1   ------------------------------------            (MCM)METHYLMALONYL-COA MUTASE PRECURSOR (EC 5.4.99.2).[Bos taurus]
>MUTA_HUMAN      -407031480  1   ----------------------------------              (MUT)METHYLMALONYL-COA MUTASE, MITOCHONDRIAL PRECURSOR (EC 5.4.99.2) (MCM).[Homo sapiens]
>MUTB_RHIME      -502552591  1     -----------------------------------           (BHBA)METHYLMALONYL-COA MUTASE (EC 5.4.99.2) (MCM).[Rhizobium meliloti]
>MUTA_MOUSE      -407769719  1     -------------------------------               (MUT)METHYLMALONYL-COA MUTASE, MITOCHONDRIAL PRECURSOR (EC 5.4.99.2) (MCM).[Mus musculus]
>MUTA_CAEEL      1847792711  1     ----------------------------------            (ZK1058.1)PROBABLE METHYLMALONYL-COA MUTASE, MITOCHONDRIAL PRECURSOR (EC 5.4.99.2) (MCM).[Caenorhabditis elegans]
>AAG58043        -2082404342  1   ---------------------------------               (sbm)Methylmalonyl-CoA mutase (MCM).[Escherichia coli O157:H7]
>Q9K8P8          -1667269011  1                 -----------------------           (MUTA)METHYLMALONYL-COA MUTASE ALPHA SUBUNIT (EC 5.4.99.2).[Bacillus halodurans]
>O28068          1960720179  1   -------------------------------------           (AF2215)METHYLMALONYL-COA MUTASE, SUBUNIT ALPHA, N-TERMINUS (MCMA1).[Archaeoglobus fulgidus]
>SBM_ECOLI       -2080424640  1   ---------------------------------               (SBM..)SBM PROTEIN.[Escherichia coli]
>Q9V0E8          847342186  1   -------------------------------------           (PAB1800)METHYLMALONYL-COA MUTASE, SUBUNIT ALPHA, N-TERMINUS (MCMA1).[Pyrococcus abyssi]
>Q9F164          -666809931  1   ------------------------------------            (MCMB)METHYLMALONYL-COA MUTASE LARGE SUBUNIT (EC 5.4.99.2).[Amycolatopsis mediterranei]
>Q9RVE5          1872287465  1     -----------------------------------           (DR1084)METHYLMALONYL-COA MUTASE, BETA SUBUNIT.[Deinococcus radiodurans]
>O74009          2126344820  1   -------------------------------------           (PH1306)563AA LONG HYPOTHETICAL METHYLMALONYL-COA MUTASE.[Pyrococcus horikoshii]
>MUTB_PORGI      1248292326  1                 -----------------------           (MUTB..)METHYLMALONYL-COA MUTASE LARGE SUBUNIT (EC 5.4.99.2) (MCM-ALPHA).[Porphyromonas gingivalis]
>Q9YBB0          1640292052  1   ---------------------------------               (APE1687)565AA LONG HYPOTHETICAL METHYLMALONYL-COA MUTASE ALPHA-SUBUNIT.[Aeropyrum pernix]
>MUTB_STRCM      -839640483  1  --------------------------------------           (MUTB)METHYLMALONYL-COA MUTASE LARGE SUBUNIT (EC 5.4.99.2) (MCM-ALPHA).[Streptomyces cinnamonensis]
>Q9CBM7          -1218394541  1     --------------------------------              (MUTB..)METHYLMALONYL-COA MUTASE,.[Mycobacterium leprae]
>Q9HKY1          -1051444486  1   ---------------------------------               (TA0462)PROBABLE METHYLMALONYL-COA MUTASE, ALPHA SUBUNIT, N-TERMINUS.[Thermoplasma acidophilum]
>MUTB_PROFR      -1667923369  1                 -----------------------           (MUTB)METHYLMALONYL-COA MUTASE LARGE SUBUNIT (EC 5.4.99.2) (MCM-ALPHA).[Propionibacterium freudenreichii shermanii]
>MUTB_MYCTU      1500890177  1     --------------------------------              (MUTB..)PROBABLE METHYLMALONYL-COA MUTASE LARGE SUBUNIT (EC 5.4.99.2) (MCM).[Mycobacterium tuberculosis]
>O66005          -1448343114  1     ----------------------------                  (ICM)COENZYME B12-DEPENDENT ISOBUTYRYLCOA MUTASE.[Streptomyces cinnamonensis]
>Q9RV41          1187248491  1   -------------------------------------           (DR1189)METHYLMALONYL-COA MUTASE, ALPHA SUBUNIT, CHAIN A.[Deinococcus radiodurans]
>Q9X949          -1176342522  1     ----------------------------                  (ICMA..)ISOBUTYRYL-COA MUTASE A (EC 5.4.99.13).[Streptomyces coelicolor]
>Q9EWD8          -1837171905  1     -----------------------------                 (MUTA2)METHYLMALONYL COA MUTASE.[Streptomyces coelicolor]
>Q9HRZ1          692672902  1      ------------------------------               (MCMA1..)METHYLMALONYL-COA MUTASE, SUBUNIT ALPHA.[Halobacterium sp.]
>Q9L1V3          -1837171908  1      ----------------------------                 (MUTA)METHYLMALONYLL-COA MUTASE.[Streptomyces coelicolor]
>Q9HRK7          1771347227  1      --------------------------------             (MCMA1..)METHYLMALONYL-COA MUTASE, SUBUNIT ALPHA.[Halobacterium sp.]
>MUTX_BACFI        198  1                          -------                  METHYLMALONYL-COA MUTASE HOMOLOG.[Bacillus firmus]
>Q9EZ60          -849052739  1                 -------------------               (MEAA)MEAA.[Streptomyces cinnamonensis]
>Q9K6D3          725212112  1                   -----------------               (BH3796)BH3796 PROTEIN.[Bacillus halodurans]
>Q9ZBK2          -608534580  1                 -------------------               (SC9C7.08C)COENZYME B12-DEPENDENT MUTASE.[Streptomyces coelicolor]
>O33614          1726761593  1                 -------------------               (MEAA)COENZYME B12-DEPENDENT MUTASE.[Streptomyces collinus]
>MEAA_METEX      1382946098  1                 -------------------               (MEAA)MEAA PROTEIN.[Methylobacterium extorquens]
>Q9L5K6            100  1                                     ----          (MUCB)PUTATIVE UV PROTECTION PROTEIN.[Salmonella typhi]
>Q9HNS5          72016314  1     ---------                                     (GLPK..)GLYCEROL KINASE.[Halobacterium sp.]
>CPJ3_RAT        1408749383  1   ---------                                       (CYP2J3)CYTOCHROME P450 2J3 (EC 1.14.14.1) (CYPIIJ3).[Rattus norvegicus]
>Q9NQM3          -1902620032  1     ---------                                     (DJ761I2.1)DJ761I2.1 (ENHANCER OF FILAMENTATION (HEF1)) (FRAGMENT).[Homo sapiens]
>CASL_HUMAN      -1902620032  1     ---------                                     (NEDD9..)ENHANCER OF FILMENTATION 1 (HEF1) (CRK-ASSOCIATED SUBSTRATE-RELATED PROTEIN) (CAS-L) (PP105) (NEURAL PRECURSOR CELL EXPRESSED DEVELOPMENTALLY DOWN-REGULATED 9).[Homo sapiens]
>METB_HAEIN      1446833676  1                          -----                    (METB..)CYSTATHIONINE GAMMA-SYNTHASE (EC 4.2.99.9) (CGS) (O-SUCCINYLHOMOSERINE (THIOL)-LYASE).[Haemophilus influenzae]
>ILVD_SYNY3         86  1                        --------                   (ILVD..)DIHYDROXY-ACID DEHYDRATASE (EC 4.2.1.9) (DAD).[Synechocystis sp.]
>Q9SY94             96  1   ------                                          (T25B24.9)T25B24.9 PROTEIN.[Arabidopsis thaliana]

Global alignment of BLAST search:

                     10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630
                      |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
Your query : SSTDQGTNPADTDDLTPTTLSLAGDFPKATEEQWEREVEKVLNRGRPPEKQLTFAECLKRLTVHTVDGIDIVPMYRPKDAPKKLGYPGVAPFTRGTTVRNGDMDAWDVRALHEDPDEKFTRKAILEGLERGVTSLLLRVDPDAIAPEHLDEVLSDVLLEMTKVEVFSRYDQGAAAEALVSVYERSDKPAKDLALNLGLDPIAFAALQGTEPDLTVLGDWVRRLAKFSPDSRAVTIDANIYHNAGAGDVAELAWALATGAEYVRALVEQGFTATEAFDTINFRVTATHDQFLTIARLRALREAWARIGEVFGVDEDKRGARQNAITSWRDVTREDPYVNILRGSIATFSASVGGAESITTLPFTQALGLPEDDFPLRIARNTGIVLAEEVNIGRVNDPAGGSYYVESLTRSLADAAWKEFQEVEKLGGMSKAVMTEHVTKVLDACNAERAKRLANRKQPITAVSEFPMIGARSIETKPFPAAPARKGLAWHRDSEVFEQLMDRSTSVSERPKVFLACLGTRRDFGGREGFSSPVWHIAGIDTPQVEGGTTAEIVEAFKKSGAQVADLCSSAKVYAQQGLEVAKALKAAGAKALYLSGAFKEFGDDAAEAEKLIDGRLFMGMDVVDTLSSTLDILGVAK 
MUTA_PROFR : SSTDQGTNPADTDDLTPTTLSLAGDFPKATEEQWEREVEKVLNRGRPPEKQLTFAECLKRLTVHTVDGIDIVPMYRPKDAPKKLGYPGVAPFTRGTTVRNGDMDAWDVRALHEDPDEKFTRKAILEGLERGVTSLLLRVDPDAIAPEHLDEVLSDVLLEMTKVEVFSRYDQGAAAEALVSVYERSDKPAKDLALNLGLDPIAFAALQGTEPDLTVLGDWVRRLAKFSPDSRAVTIDANIYHNAGAGDVAELAWALATGAEYVRALVEQGFTATEAFDTINFRVTATHDQFLTIARLRALREAWARIGEVFGVDEDKRGARQNAITSWRDVTREDPYVNILRGSIATFSASVGGAESITTLPFTQALGLPEDDFPLRIARNTGIVLAEEVNIGRVNDPAGGSYYVESLTRSLADAAWKEFQEVEKLGGMSKAVMTEHVTKVLDACNAERAKRLANRKQPITAVSEFPMIGARSIETKPFPAAPARKGLAWHRDSEVFEQLMDRSTSVSERPKVFLACLGTRRDFGGREGFSSPVWHIAGIDTPQVEGGTTAEIVEAFKKSGAQVADLCSSAKVYAQQGLEVAKALKAAGAKALYLSGAFKEFGDDAAEAEKLIDGRLFMGMDVVDTLSSTLDILGVAK  MUTA_PROFR  
MUTA_STRCM :                       AAEFPDATHEQWHRLVEGVV---RKSGKDVSGTAAEEALSTTLEDGLTTRPLYTARDAAPDAGFPGFAPFVRGSVPEGNTPGGWDVRQRYASADPARTNEAVLTDLENGVTSLWLTLGSAGLPVTGLERALDGVYLDLVPVALDAGSEAATAARELLRLYEAAGVADDAVRGTLGADPLGHEARTGEKSTSFAAVAELARLCGERYPGLRALTVDALPYHEAGASAAQELGASLATGVEYLRALHDKGLGVEKAFAQLEFRFAATADQFLTIAKLRAARRLWARVAEVSGVPA--AGAQRQHAVTSPVMMTRRDPWVNMLRTTVACLGAGVGGADAVTVLPFDHELGLP-DAFARRIARNTSTILLEESHLARVIDPAGGSWYVERLTDELAHAAWDFFKEIERADGQVAALRSGLVGDRIAATWAERRKKLARRREPITGVSEFPLLTERPVEREPAPAAPP-GGLPRVRRDEAYEELRGRSDAHLEATGARPKVFIAALGPAAAHTARATFAANLFMAGGVEPVHDPVSVDAETAAEAFAASGATVACLCSSDVLYAEQA-EAVARALKSAGALRVFLAGRGEFAD--------IDEYVFAGCDAVAVLTSTLDRMGVA  MUTA_STRCM  
Q9F165     :                       AAEFPQATREQWQELVAGVLRKSGKLPEDFAGAPE--SKLVTRTYDGIEIQPLYTAEDVPGDIGFPGLPPYVRGARPDGQVSTGWDVRARFTGDDARAVNQAILADLEGGVTSIWLSVPPASLA-----DALNEVYLDLAPVVLDAGTSYEAAAEALFELFDEREIPASEATAVLGADPIGLAARSGSAMALEPAAALAARVAGKYPKVRTIVADGLPFHEAGGSDAQELGALVAAGVTYLRSLTDAGLDVEAAAGQLEFRLAATADQFSTIAKLRAARRLWARVAEVCGFASPMR---QHAVTSPAMLTRRDPWVNMLRTTVACFGAGAGGADAVTVLPFDAAIGRP-DSFSARIARNTHAVLLEEAKLAGVADPAGGSWYVEKLTDDLAHAAWAEFTAIEGAGGLVAELASGALAGRLASTWEKRSKRIATRRDPLTGVSEFPNLAEKPV-VRTRLESPVDGGLPRHRYAEGFEALRDASDAYLASHGERPKVFLATLGPVAAHTARAGFAANLFQAGGIEA--VNPGATDDLPGAFRASGAKIACLCGTDDAYAAQAAEVAESLGAEYVLLA---------GKGSYDG---VDANVFAGCDALEVLDGLHAKLGVAR  Q9F165  
MUTA_MYCTU :                                 RWRNAVAGVLSKSNRTDSAQLGDHPERLLDTQTADGFAIRALYTAFDELPEPPLPGQWPFVRGGDPLRDVHSGWKVAEAFPANGATADTNAAVLAALGEGVSALLIRVGESGVAPDRLTALLSGVYLNLAPVILDAGADYRPACDVMLALVAQLDPGQRDTLSIDLGADPLTASLRDRPAPPIEEVVAVASRAAG-ERGLRAITVDGPAFHNLGATAATELAATVAAAVAYLRVLTESGLVVSDALRQISFRLAADDDQFMTLAKMRALRQLWARVAEVVG-DPGGGAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGVGGADTVLVHPFDVAIPGGFPGTAAGFARRIARNTQLLLLEESHVGRVLDPAGGSWFVEELTDRLARRAWQRFQAIEARGGFVEA--HDFLAGQIAECAARRADDIAHRRLAITGVNEYPNLGEPALPPGD-PTSPVRRYAAG------FEALRDRSDHHLARTGARPRVLLLPLGPLAEHNIRTTFATNLLASGGIEAIDPGTVDAGTVGNAVA--DAGSPSVAVICGTDARYRDEVADIVQAARAAGVSRVYLAGPEKALGDAAHRPDEFLTAKI----NVVQALSNLLTRLG  MUTA_MYCTU  
Q9CBM6     :                                 RWRRAVAGVLSRSMRRDPA-TFGDQPERLLDTATYDGFAIRPLYTVFDELPESSLPGEWPYRRGGDALRDVHSGWKVTEVFPVDPATAGVAADEGTASNATILAALAEGVSALRIRVGQSGVAPGQLDSLLLGVYVDLVPVILDAGADYVEACDAVLALLARLDSSRRTMLSIDLGADPLTASLSGRPAPSIDQVVAVAARVAG-DRGVRAITVDGPAFHNLGASATWELAAAIAAAVTYLRVLTESKMPVSEALRQISFRLAADDDQFLTIAKIRAVRQLWARIAEVAG-DPEGGAAVVHAETSLPMMTQRDPWVNMLRGTLAAFGAGVGGADTVLVFPFDVAIPGGFLGMAAS-FARRIARNTQLLLLEESHVGRVLDPAGGSWFVENLTEQLAQQAWQHFQAIETYGGFVDA--GDYLAGQIHETAARRTDDIAHRRTAITGVNEYPNLAEPALLHGGSPVVATAAGNLL-RYAAGFEALRDRSDAYLARTGARPQVLLLPLGPLAEHNIRATFATNLLASGGIAAINLGSVDAPGVVQAVAQAGFMAGSSMVVVICGTDLRYRDEAADVVEAARGAGVSWVYLAGPEKALG-DINNAKSRPDEYITAKINAVEALSNLLTRLG  Q9CBM6  
Q9K8P7     :                         EFPIPTYDEWRKVAEASLKGAAFDQKLLT----------KTLEGLTLEPMYQQRDVDELHISERHVHPVKR----KNG---KWLVSQELTQGTPESFNRTA-KNDLARGQTALHMVIDQTVRDGLSPADQKGETGRTGLLLYNHEDMETALEGIDVSSVPIHLNGGAVQTPFLASLLAIAPTSLHGVVGADP----IHEWVKKGSLSYSWRTVFDELSHSVQVVNERALDLKTILVQSHVYHNGGATATEELAFLLATGVQYVRALLERDIAIDDIGRSFCMSVSVGSDLFKEIAKLRALRLLWANIMEAFGAEKEGRNIWLHARTSFYTKTVYDPYVNMLRGTGEAFAAAVGGADSLHVSPFDEPIQKP-SPFSRRIARNTSIILQEEAHIGQVEDPAAGSWYVEVLTEKLGEAAWSLFQTIESEGGM--------IASLEKGLPQQWVERSRQRQEQAAEVRKTVMVGTNRYVAIDEKPLTKQEEEPIAPYREAI  Q9K8P7  
MUTA_PORGI :                         EFPPVSREAWIDKITADL-KGVPFEKKLVW---------RTNEGFNVNPFYRREDIEDLKTTTSLPDEYPYVRSTRMHNEWLVRQDI--VVGDNVAEANEKA-LDLLNKGVDSLGFYLKKVHINVDTLAALLKDI--ELTAVELNFNCCITRAADLLSAFSAYVKKVGADPNKCHGSVSYDPFKKQLVRGVSNPDWVKMTLPVMDAARELPAFRVLNVNAVNLSDAGAFITQELGYALAWGAELLDKLTDAGYKPEEIASRIKFNFGIGSNYFMEIAKFRAARWLWAQIVGSYGDQYKNETAKIHQHATTSMWNKTVFDAHVNLLRTQTETMSAAIRGVDSITVLPFDVTYQ-QSDDFSERIARNQQLLLKEECHFDKVIDPSAGSYYIETLTNSIGEEAWKLFLSVEDAGGFTQAAETASIQKAVNASNIKRPVG-ATRREIFLGTNQFPNFTEVAGDKITLAQGEHDCNCVKSIEPLNFSRGASEFEALRLATEKSGKTPVVFMLTIGNLAMRLARSQFSSNFFGCAGYKLIDNLGFKSVEEGVDAALAAKADIVVLCSSDDEYAE  MUTA_PORGI  
Q9GK13     :                                 EWAALAKKQL-KGKNPED----------LIWHTPEGISIKPLYSKRDTMDLPEEL--PGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRLRGDVGMAGVAIDTVEDTKILFDGIPLEKMSV-SMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFQYTAKHMPKFNSISISGYHMQEAGADAILELAYTIADGLEYCRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMLQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIIRTTIEAMAAVFGGTQSLHTNSFDEALGLPTVK-SARIARNTQIIIQEESGIPKVADPWGGSYMMESLTNDIYDAALKLINEIEEMGGMAKAV-AEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEESVDVLAIDNTSVRNKQIEKLKKVKSSRDQALAERCLDALTA  Q9GK13  
MUTA_HUMAN :                                 EWAALAKKQL-KGKNPED----------LIWHTPEGISIKPLYSKRDTMDLPEEL--PGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSV-SMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVK-SARIARNTQIIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAV-AEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVE  MUTA_HUMAN  
MUTB_RHIME :                                                             LVWHTPEGIDVKPLYTSDDMSGIRHLNSLPGFEPFVRRPRATMYAGRPWTVRQYAGFSTAEASNAFYRRNLAAGQQGVSVAFDLATHRGYDSDHPRVQGDVGKAGVAIDSVEDMKILFDGI-PLDRISV-SMTMKGAVIPILASFIVAGEEQGVSRDKLSGTIQNDILKEFMVRNTYIYPPEPSMRIVADIIEYTAKEMPKFNSISISGYHMQEAGATLVQELAFTLADGREYVRAALAKGLNVDDFAGRLSFFFAIGMNFFMEAAKLRAARLLWTRIMQEFKPEKASSLMLRTHCQTSGVSLQEQDPYNNIVRTAFEAMSAVLGGTQSLHTNSFDEAMALPTD-FSARIARNTQLILQHETGVTKVVDPLAGSYYVESLTNELAEKAWGLIEEVEALGGMTKAVNAGLPKRLIEEAATRRQAAVDRAEEVIVGVNKYRLENEQPIDILQIDNAAVRTAQVKRIEETRRRRDSQKMKQALDALADVARSGK  MUTB_RHIME  
MUTA_MOUSE :                                                                HTPEGISIKPLYSRADTLDLPEEL--PGVKPFTRGPYPTMYTYRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSV-SMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFQYTAQHMPKFNPISISGYHMQEAGTDAILELAYTIADGLEYCRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHSNSFDEALGLPTVK-SARIARNTRIIIQEESGIPKVADPWGGSYMMESLTNDVYEAALKLIYEVEEMGGMAKAV-AEGIPKLRIEECAARRQARIDSGSEVIVGVNKY  MUTA_MOUSE  
MUTA_CAEEL :                                                             LTWNTPEGIPIKPLYLRSDRDCDAQRSVELPGQFPFTRGPYPTMYTQRPWTIRQYAGFSTVEESNKFYKENIKAGQQGLSVAFDLATHRGYDSDNPRVFGDVGMAGVAVDSVEDMRQLFDGINLEKMSVSMTMNGAVVPVLAMYVVAAEEAGVSRKLLAGTIQNDILKEFMVRNTYIYPPEPSMRIIGDIFAYTSREMPKFNSISISGYHMQEAGADAVLEMAFTIADGIQYCETGLNAGLTIDAFAPRLSFFWGISMNFYMEIAKMRAARRLWANLIKERFSPKSDKSMMLRTHSQTSGWSLTEQDPYNNIIRTTIEAMASVFGGTQSLHTNSFDEALGLPTK-FSARIARNTQIIIQEESGICNVADPWGGSYMMESLTDEIYEKALAVIKEIDELGGMAKAVASGMTKLKIEEAAAKKQARIDAGKDVIVGVNKYRLDHEQQVEVLKIDNAKVREEQCAKLNHIRATRDAEKAQKALDAIT  MUTA_CAEEL  
AAG58043   :                             SNEQEWQQLANKELSRRE---------KTVDSLVQQTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYVRGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDNPRVAGDVGKTGVAIDTVEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIIAAEEQGVTPDKLTGTIQ-NDILKEYLCRNTYIYP--------PKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGANCVQQVAFTLADGIEYIKAAISAGLKIDDFAPRLSFFFGIGMDLFMNVAMLRAARYLWSEAVSGFGAQDPKSLALRTHCQTSGWSLTEQDPYNNVIRTTIEALAATLGGTQSLHTNAFDEALGLPTD-FSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIVKQARAIIQQIDEAGGMAKAIEAGLPKRMIEEASAREQSLIDQGKRVIVGVNKYKL  AAG58043  
Q9K8P8     :                                                                                                                                                                                                                  EASMKVIADIFEYTSNYMPKFNSISISGYHMQEAGATADLELAYTLADGLEYVRTGMKAGLDIDAFAPRLSFFWAIGMNHFMEVAKMRAARLIWAKLMKRFNPKNPKSLALRTHSQTSGWSLTEQDPYNNVVRTCVEALAAALGHTQSLHTNALDEAIALPTD-FSARIARNTQLYLQDETGITNVLDPWGGSYYVESLTAELLQKAWANIEEIEELGGMAKAIDTGLPKMRIEEAAARRQAKIDSGKEAIIGVNKYRPDTEEPLDILDIDNTAVREAQIRRLEKLKAERDEERVQQALNRITKAAETEK  Q9K8P8  
O28068     :                               KKEWEEKYVKPLLE-RSPERKKEFK---------TSSGIVVDRLYTPEDVEIDYENKLGYPGVYPFTRGVYPTMYRGRL--WTMRQYAGFGTAEETNRRYRYLLEQGQTGLSVAFDLPTQIGYDSDHPMALGEV-GKVGVAIDTIEDMEILFNGIPLGKVSTSMTINSTCAQILSMYVAVAEKQGVERANLRGTVQNDMLKEYIARGTYIFPPEPSLRLATDIIMFCAKEMPKWNSISISGYHMEEAGATPVQEVAFTLADGITYVEKVIERGMDVDSFAPRLSFFFAAGNNFLEEIAKFRAARRLWARIMKERFNAKNPRSMMLRFHVQTAGCTLTAQQPENNIVRVALQALAAVLGGCQSLHTNSFDEALCLPTEK-AVRIALRTQQIIAEESGVADVVDPLGGSYYIEWLTDRIEEEAMKYIEKIDEMGGMIKAIESGYVQREIQKSAYEKQKAIDEGEITVVGVNKYQIEEEIQIELLRVDKAVVEKQIRRLQEFRKNRDAKKVEEALDRLRKAAEK  O28068  
SBM_ECOLI  :                                QEWQQLANKELSRRE---------KTVDSLVHQTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYVRGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDNPRVAGDVGKAGVAIDTVEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGVTPDKLTGTIQ-NDILKEYLCRNTYIYP--------PKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGANCVQQVAFTLADGIEYIKAAISAGLKIDDFAPRLSFFFGIGMDLFMNVAMLRAARYLWSEAVSGFGAQDPKSLALRTHCQTSGWSLTEQDPYNNVIRTTIEALAATLGGTQSLHTNVFDEALGLPTD-FSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIVKQARAIIQQIDEAGGMAKAIEAGLPKRMIEEASAREQSLIDQGKRVIVGVNKYKL  SBM_ECOLI  
Q9V0E8     :                            KEEEKRWEETTVKKFLEKA--PERKEKFM---------TDDGFEIKRIYTPADLGENWDYLEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYATAEESNKRYKYLLSQGQTGLSVAFDLPTQLGYDSDHPLAEGEVGKVGVAIDSLWDMRILFDGIPLDKVSTSMTINATAANLLAMYILVAEEQGVPQEKLRGTVQNDILKEYIARGTYIFPPQPSMRLTTDIIMYCAENVPKWNPISISGYHIREAGANAVQEVAFTLADGIEYVKAVIERGMDVDKFAPRLSF-FFAAHNNFLEEIAKFRAARRLWAYIMKEWFNAKNPRSMMLRFHTQTAGSTLTAQQPENNIIRVAIQALAAVLGGTQSLHTNSYDEALSLPTEK-SVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIFEEALKYIEKIQKMGGMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNKF--VTDEPIEVEILKVDPSIRDKQIERLKKLRSERDNKKVEEALDKLRNAAEK  Q9V0E8  
Q9F164     :                                DAWARAVENATGKG--PDA----------LAWETPEGIGVKPVYTAADLSDVDFLGTYPGIAPFLRGPYPTMYVNQPWTIRQYAGFSTAEESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVSGDVGMAGVAIDSIYDMRQLFDGIPLDKMSV-SMTMNGAVLPVLALYVVAAEEQGVKP-EQLAGTIQNDILKEFMVRNTYIYPPQPSMRIISDIFAFTSQHMPKYNSISISGYHMQEAGATADLELAYTLADGVEYLRSGVDAGLSVDKFAPRLSFFWAIGMNFFMEVAKLRAARLLWAKLVKGFDPSSSKSLSLRTHSQTSGWSLTAQDVYNNVVRTCVEAMAATQGHTQSLHTNALDEALALP-TDFSARIARNTQLLLQQESGTTRVIDPWGGSAFVEKLTYDLARKAWGHITEVERAGGMAKAIDAGIPKLRIEEAAARTQARIDSGRQPVIGVNKYQVTDDEEIDVLKVDNAGVRAQQLEKLRRLRSERDSAATEDALRRLT  Q9F164  
Q9RVE5     :                                                             LNRETPEGLTLKPLYTRADTAGLNTDTLPGLPPYTRGPRATMYAARPWTIRQYAGFSTAEESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVVGDVGKAGVAIDSVEDMKILFDGIPLNEMSVSMTMNGAVLPILAGYIVVGLEQGAKLEELSGTIQ-NDILKEFMVRNTYIYP--------PEPSMRIIADIIEYTAQNMPRFNSISISGYHLQEAGANAALELAYTLSDGLEYVRAALGKGLDVDAFAPRLSFFFAIGMNFYTEVAKLRAARLLWDEIMAQFSPKNPMSRALRTHCQTSGWSLTEQDPYNNVVRTAVEAMAAVFGGTQSLHTNSFDEAIGLPTD-FSARIARNTQLIIQEETGIPQVVDPWGGSYLMERLTHDLAEKARELMREVESLGGMAKAIESGVPKLRIEESAARKQARIDRGEDVIVGVNKYRPTAETPVDVLDIDNAAVRESQIARLNKLRGERDGEAVQAALSALTECAK  Q9RVE5  
O74009     :                            KEEEKRWEETTVKKFLEKA--PERKEKFM---------TDDGFEIKRIYTPADLGEDWNYMEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYATAEESNKRYKYLLSQGQTGLSVAFDLPTQLGYDSDHPLAEGEVGKVGVAIDSLWDMRILFDGIPLDKVSTSMTINSTAANLLAMYILVAEEQGVSQEKLRGTVQNDILKEYIARGTYIFPPQPSMRLTTDIIMYCAENVPKWNPISISGYHIREAGANAVQEVAFTLADGIEYVKAVIERGMDVDKFAPRLSF-FFAAHNNFLEEIAKFRAARRLWAYIMKEWFNAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVLGGTQSLHTNSYDEALSLPTEK-SVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQKMGGMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAF--VTDEPIEVEILKVDPSIREKQIERLKKLRSERDNKKVQEALDKLRNAAEK  O74009  
MUTB_PORGI :                                                                                                                                                                                                                  EFSMRIIADIFEYTSQNMPKFNSISISGYHMQEAGATADIEMAYTLADGMQYLKAGIDAGIDVDAFAPRLSFFWAIGVNHFMEIAKMRAARLLWAKIVKSFGAKNPKSLALRTHSQTSGWSLTEQDPFNNVGRTCIEAMAAALGHTQSLHTNALDEAIALPTD-FSARIARNTQIYIQEETLVCKEIDPWGGSYYVESLTNELVHKAWTLIKEVQEMGGMAKAIETGLPKLRIEEAAARTQARIDSHQQVIVGVNKYRLPKEDPIDILEIDNTAVRKQQIERLNDLRSHRDEKAVQEALEAITKCVE  MUTB_PORGI  
Q9YBB0     :                            EASLKKWESETLPQWLE-RMPERMESFT---------TLSDIPVRRLYTPLDLKDWDYLEKLGFPGEYPFTRGIHATMYRAKLWTMRMFSGYGGPEETNKRLKFLIEHGETGLSLAFDEPTLVGIDPDDPLAEGHVGIEGVNVASLKDMEIIFDGIDMGRVTTNMTINPPAPVLLSYYVAVAEKQGVPYHKIGGTTQNDPLKEFIAQKTYVFPPEAAVKIAIDVIEWSVKNLPKWNPISISGYHIREAGATAVQELAFTLADGIEYVRQLLARGLDVDTFAPRLSFFFDSHINFFEEIAKFRAARRMWAKIMKEWFGAKKKRSMWLRFHTQTAGVSLVVQEPYNNIVRTAIEALAAVLGGTQSLHTNSFDEPFRVPSE-FAAKIALRTQQIIAYETGVADTIDPLGGSYYVEWLTDEIEERAWKYIDKIEAMGGMLEAVKRGYPQKEVTESAYKFQRDLEEGRKFIVGVNIF  Q9YBB0  
MUTB_STRCM :                       AGGGPSGSAEQWRAAVKESVGKSESD------------LLWETPEGIAVKPLYTGADVEGLDFLETYPGVAPYLRGPYPTMYVNQPWTIRQYAGFSTAEESNAFYRRNLAAGQKGLSVAFDLPTHRGYDSDHPRVTGDVGMAGVAIDSIYDMRQLFDGIPLDKMTV-SMTMNGAVLPVLALYIVAAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPKPSMRIISDIFAYTSQKMPRYNSISISGYHIQEAGATADLELAYTLADGVEYLRAGQEAGLDVDAFAPRLSFFWAIGMNFFMEVAKLRAARLLWAKLVKQFDPKNAKSLSLRTHSQTSGWSLTAQDVFNNVTRTCVEAMAATQGHTQSLHTNALDEALALPTD-FSARIARNTQLLIQQESGTTRTIDPWGGSAYVEKLTYDLARRAWQHIEEVEAAGGMAQAIDAGIPKLRVEEAAARTQARIDSGRQPVIGVNKYRVDTDEQIDVLKVDNSSVRAQQIEKLRRLREERDDAACQDALRALTAAAER  MUTB_STRCM  
Q9CBM7     :                                                                HTPEGIDVKPVYIAADRAAAEAGGYPLHSFPGEPPYLRGPYPTMYVNQPWTIRQYAGFSTAADSNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQGDVGMAGVAIDSILDMRQLFDGIDLSAVSV-SMTMNGAVLPILALYVVAAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPEPSMRIISDIFAYTSAKMPKFNSISISGYHIQEAGATADLELAYTLADGVDYIKAGLDAGLDIDTFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAKFGPQSPKSLSLRTHSQTSGWSLTAQDPFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTD-FSARIARNTQLVLQQESGTTRPIDPWGGSYYVEWLTHQLAARARTHIAEVAEHGGMAAAISDGIPKLRIEEAAARTQARIDSGRQPVVGVNKYQVDQDHEIE  Q9CBM7  
Q9HKY1     :                                EEYERWVSSTL---APWNRQTGY----KEKKYQNSSEITLKEVYTKEDVPDLDRKLGMPGEYPFTRGIYPNMYRGKLWTMRMFSGFGTPEDTNRRLHYLIENGETGLSIAFDMPTLYGYDADNPRSEGEIGKCGVNVSTLKDMETIFKGIDLSKVSTSMTINAPAAILTAMYLAIAKKQGVPFDKVSGTVQADILKEYIAQKEWMYPPEAHIRIIRDMMVYCTKNVPKWNYISISGYHIREAGSSAVQELAFTLADGFYYVDLGIKAGLNVDEFAPRLSFFFNSSINFFEEIAKMRAARRIWATVLKEKYGAKNPRSMMLRFHTQTSGYTLTWQQPLNNIIRTTIEAMAAVLGGTQSLHTNSYDEAWALPSDQ-AVKVALRTQQIIAEESGIPDVIDPLGGSYYVEWLTDRMEEEAYRYFDRIESMGGILEAIKKGYIQKEIADTSYKRQKRLESGEEIMVGVNKY  Q9HKY1  
MUTB_PROFR :                                                                                                                                                                                                                  QPSMRIISEIFAYTSANMPKWNSISISGYHMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQFAPRLSFFWGIGMNFFMEVAKLRAARMLWAKLVHQFGPKNPKSMSLRTHSQTSGWSLTAQDVYNNVVRTCIEAMAATQGHTQSLHTNSLDEAIALPTD-FSARIARNTQLFLQQESGTTRVIDPWSGSAYVEELTWDLARKAWGHIQEVEKVGGMAKAIEKGIPKMRIEEAAARTQARIDSGRQPLIGVNKYRLEHEPPLDVLKVDNSTVLAEQKAKLVKLRAERDPEKVKAALDKITWAAGNP  MUTB_PROFR  
MUTB_MYCTU :                                                           EQLVWHTPEGIDVTPVYIAADRAAAEAEGYPLHSFPGEPPFVRGPYPTMYVNQPWTIRQYAGFSTAADSNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQGDVGMAGVAIDSILDMRQLFDGIDLSTVSVSMTMNGAVLPILALYVVAAEEQGVAPEQLAGTIQ-NDILKEFMVRNTYIYP--------PKPSMRIISDIFAYTSAKMPKFNSISISGYHIQEAGATADLELAYTLADGVDYIRAGLNAGLDIDSFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAQFAPKSAKSLSLRTHSQTSGWSLTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTD-FSARIARNTQLVLQQESGTTRPIDPWGGSYYVEWLTHRLARRARAHIAEVAEHGGMAQAISDGIPKLRIEEAAARTQARIDSGQQPVVGVNKYQVPEDHEIE  MUTB_MYCTU  
O66005     :                                                                 TLSGDPVDPVYGPRPGDTYDGFERIGWPGEYPFTRGLYATGYRGRTWTIRQFAGFGNAEQTNERYKMILANGGGGLSVAFDMPTLMGRDSDDPRSLGEVGHCGVAIDSAADMEVLFKDIPLGDVTTSMTISGPAVPVFCMY--------LVAAERQGVDPA---VLNGTLQTDIFKEYIAQKEWLFQPEPHLRLIGDLMEHCARDIPAYKPLSVSGYHIREAGATAAQELAYTLADGFGYVELGLSRGLDVDVFAPGLSFFFDAHVDFFEEIAKFRAARRIWARWLRDEYGAKTEKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALAAVLGGTNSLHTNALDETLALPSEQ-AAEIALRTQQVLMEETGVANVADPLGGSWYIEQLTDRIEADAEKIFEQIRERG  O66005  
Q9RV41     :                           PMKTKNEWMQSVYQPATQ-KFPERKYNFKN---------LSDMDPEPIYTADDLTDWDAERDLGYPGEFPYTRGVQSSVYRGKL--WTMRMFAGFXSAEQTNERFHSLLKAGQTGLSTAFDLPTLMGYDSDHPFSKGEVGKCGVAVSSLADMEILFQGIDPTAVTTSMTINSPANAVWAMYIANAQKQGKDLGKVGGTIQNDILKEFIAQKEFIYPPAPSVKLVIDTFEWGPKMLPKWNFISVSGYHIREAGATGVQELAFTLADGFHYVEKALERGLDIDEFAPRISFFWDIHNDFFEEIAKLRAARRIWARQMRDRYGAKNPKSWMLRTHSQTAGVSLPAQQPLNNIARVAIQALAAVLGGTQSLHTDAFDEALALPTEE-SAAIALRTQQIIAYETGVAGVVDPLAGSYYVEKLTNDIEAAAMGYIEQIRMMGGVEAGIDNGFFQLEMAEAAYRYQREVETKDRIIVGVNEYVQDAVEVPIQIIDPKVEELQASRLAQVRRERDPQRAEKALEALRDTAVTGANSMPAFLEC  Q9RV41  
Q9X949     :                                                                 TLSGDPVEPVYGPRPGDEYEGFERIGWPGEYPFTRGLYPTGYRGRTWTIRQFAGFGNAEQTNERYKMILRNGGGGLSVAFDMPTLMGRDSDDPRSLGEVGHCGVAIDSAADMEVLFKDIPLGDVTTSMTISGPAVPVFCMYLVAA---------ERQGVDASVLNGTLQTDIFKEYIAQKEWLFQPEPHLRLIGDLMEYCAAGIPAYKPLSVSGYHIREAGATAAQELAYTLADGFGYVELGLSRGLDVDVFAPGLSFFFDAHLDFFEEIAKFRAARRIWARWMRDVYGARTDKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALAAVLGGTNSLHTNALDETLALPSEQ-AAEIALRTQQVLMEETGVANVADPLGGSWFIEQLTDRIEADAEKIFEQIKERG  Q9X949  
Q9EWD8     :                                                             MTRESESGLPIEPVYGPEALADWEAAEKLGEPGKYPFTRGVYPSMYTGRPWTMRQYAGFGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAIDSIDDMRVLFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADQLTGTIQNDVLKEYIARGTYIFPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYVRTAVAAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMKEEFGAKNPKSLMLRFHTQTAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDK-SARLALRTQQVLAYETDVTATVDPFAGSYVVEKMTDDVEAAALELMGKVEDLGGAVNAI  Q9EWD8  
Q9HRZ1     :                                                                    GQSVDRLYTPDDVADRDYDADIGFPGEEPYTRGVYPTMYRGRL--WTMRQYAGMGTAAETNERFNYLLDEGQTGLSMAFDLPTQMGYDSDATMAQGEVGKSGVAIDTLADMETVFDGIPLDEVSTSMTINAPASVLLAMYIAVGDQQGVDREELRGTIQNDILKEYIARNTYIFPPEPSMRVITDIFEFCAAETPKFNTISISGYHIREAGATAAQEIAFTLGDGIEYVQTALDAGLDVDEFAPQLSFFFNAHNNILEEVAKFRAARRMWATIMEERFDAQNPKSKQLKFHTQTAGSTLTAQQIDNNIVRVAYQALAAVLGGTQSLHTNGKDEALSIPTEE-SVRTALRTQQILAHESGAADTIDPLAGSYYVEGLTDDIEAEAQAILDEVDSRGGMRRAVEDQWVQRQIQDVAFDRQQEIEEKERVIVGVNEF  Q9HRZ1  
Q9L1V3     :                                                                    GLPIEPVYGPDALADWDAAEKLGEPGKYPFTRGVYPSMYTGRPWTMRQYAGFGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAIDSIDDMRVLFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADKLTGTIQNDVLKEYIARGTYIFPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYVRTAVAAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMKEEFGAKNPKSLMLRFHTQTAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDK-SARLALRTQQVLAYETDVTATVDPFAGSYVVERMTDDVEAAALELMGKVEDLGGAVNAI  Q9L1V3  
Q9HRK7     :                                                                     MEVDRLYTPADVADTDYNEDLGFPGEFPYTRGVYPTGYRGRTWTMRQFAGFGTAEETNERFHYLIDNGQTGLSTAFDMPSLMGLDSDHRMSLGEVGKEGVAVDTLRDMEILFDGIDLAAVSTSFTINPSAPVIYAMYLALADQQGVPREDIRGTLQNDMLKEFIAQKEWVVPPTPSLDLVTDVVEYCVAETPNFHPISVSGYHIREAGSTAVQELAFTLADGFAYVEDAIDRGLDVDAFAPQLSFFFNSHNAIFEEVAKFRAARRIYATLMDDWYGAEADAATQLKFHTQTAGQSLTAQQPKNNIARVTLQALAAVLGGSQSIHTNSFDEALALPSEE-AVRVALRTQQIIAEESGAADIVDPLGGSFAVESLTNEIEAEAMAYLTEIKELGDGSVRDGVLAGIADGYFHREIQESAYEYQSRVDDGEETVVGVNEHEMDADTSPDTLHVDAEATR  Q9HRK7  
MUTX_BACFI :                                                                                                                                                                                                                                                                                                                                          LTNMDPYVNMLRGTSEAFSAAVAGADSIQVSPFDEPIQ-PSTSFSRRIARNTSLILMEESHLAATQDASGGAWYVEHLTDEIIVCKFK  MUTX_BACFI  
Q9EZ60     :                                                                                                                                                                                                                   PSLRLTTDMITYTVAHIPKWNPINICSYHLQEAGATPVQEIAYAMSTAIAVLDAVRDSGQVPEEKFGDVVARISFFVNAGVRFIEEMCKMRAFGRIWDQVTRERYGIENPKHRRFRYGVQVNSLGLTEAQPENNVQRIVLEMLAVTLSKDARARAVQLPAWNEALGLPRPWDQQWSLRIQQ----VLAHESDLLEYEDIFDGSHVVEAKVASLVDESLAEMDRIEKMGGAMAAVESGYLKSQLVSSHAERRARIESGQEKIVGVNSY  Q9EZ60  
Q9K6D3     :                                                                                                                                                                                                                                                YHIAEAGANPISQLAFTLANGFTYVEYYLSRGMDINDFAPNLSFFFSNGLDPEYTVIGRVARRIWSTVMKHKYGANERSQKLKYHIQTSGRSLHAQEIDFNDIRTTLQALMAIYDHCNSLHTNAYDEAITTPTEQ-SVRRAMAIQMIITKELGLAKNENSLQGSFIIEELTELVEEAVLAELEQINDRGGVLGAMETQYQRSKIQEESMHYEMKKHSGELPIIGVNTY  Q9K6D3  
Q9ZBK2     :                                                                                                                                                                                                                   PSLRLTTDMIAYTVSHLPKWNPINICSYHLQEAGATPVQEIAYAMSTAIAVLDAVRDSGQVPQERMGDVVGRISFFVNAGVRFVEEMCKMRAFGRIWDRVTRERYGIENPKHRRFRYGVQVNSLGLTEAQPENNVQRIVLEMLAVTLSKDARARAVQLPAWNEALGLPRPWDQQWSLRIQQ----VLAHESDLLEYEDLFEGSKVVEAKVDELVEAAFAEIERIQEMGGAMAAVESGYLKSQLVASHAERRARIESGEEKIIGVNAF  Q9ZBK2  
O33614     :                                                                                                                                                                                                                   PSLRLTTDMIAYTCSHIPKWNPINICSYHLQEAGATPVQEIAYAMSTAIAVLDAVRDSGQVPQERMGDVVARISFFVNAGVRFIEEMCKMRAFGRIWDKVTRERYGIENPKQRRFRYGVQVTSLGLTEAQPENNVQRIVLEMLAVTLSKDARARAVQLPAWNEALGLPRPWDQQWSLRIQQ----VLAYESDLLEYEDIFEGSKVIEAKVDQLVTDVLAEMDRIQEMGGAMAAVESGYLKSQLVASHAERRARIESGQEKIVGVNVF  O33614  
MEAA_METEX :                                                                                                                                                                                                                   PSLRLTKDVILFTTKNVPKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRDDPDFDEASFSDVFSRISFFVNAGMRFVTEICKMRAFAELWDEIAQERYGITDAKKRIFRYGVQVNSLGLTEQQPENNVHRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRMQQ----ILAFETDLLEYDDIFDGSTVIEARVEALKEQTRAELTRIAEIGGAVTAVEAGELKRALVESNARRISAIEKGEQIVVGVNKW  MEAA_METEX  
Q9L5K6     :                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              FDERPARRG------SEALMKVMDRFNK-EHRGSLFLACEGIHQDFRGKQAMLSP  Q9L5K6  
Q9HNS5     :                                                              SVDTTDGVYMVPAFTGLGAPHWDGR------ARGTLVGMTRGTRKAHIVRATLESIAYQTRDIAAAMEADSGVSTTTLRVDGGAVKNNFLCQLQSDIIQTDLARPEVDETTALGAAYAAGLAV  Q9HNS5  
CPJ3_RAT   :                               QEKMQAEIDRVIGQGRQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREV-------AVDTYLAGFNLPKGTMILTNLTALHRDPKEWAT--------------------PDTFNPEHFLE  CPJ3_RAT  
Q9NQM3     :                                                       AETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANA  Q9NQM3  
CASL_HUMAN :                                                       AETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANA  CASL_HUMAN  
METB_HAEIN :                                                                                                                                                                                                                                                                                                                                            QDEAWVNTFLKSIKLITFAESLGGTESFITYPATQTHMDIPESE---RVARGITNTLLRFSVGIEDVED  METB_HAEIN  
ILVD_SYNY3 :                                                                                                                                                                                                                                                                                                                  IAEVLADIPDQPPAGQDVIHSWDDPVYQEGHLAVLKGNLAT-EGSVAKISGVKKPVITGPAKVFESEEDCLEAILAGKIQAGDVVVVRYEGPKGGPGMREMLAPTSA  ILVD_SYNY3  
Q9SY94     :                                KSWHHTAKKNIKHGRTSESTTPFSS---RPTTPTHGSS---PIHLLRNAPHKRSRSVDESFANSFSPRNSDFDSWDPESQHE  Q9SY94