PSATool output page

The sequence you entered is as below:

MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY
HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN
HNRTTT

The Length of the aminoacid sequence is : 126 residues

The total molecular weight of the given sequence is : 14470.16 Daltons
Aminoacid Frequency %composition %wt composition G 5 3.97 1.97 A 14 11.11 6.87 V 3 2.38 2.05 L 13 10.32 10.16 I 3 2.38 2.34 S 4 3.17 2.41 T 10 7.94 6.99 Y 6 4.76 6.76 C 4 3.17 2.85 M 2 1.59 1.93 D 3 2.38 2.38 N 6 4.76 4.73 E 7 5.56 6.24 Q 8 6.35 7.08 K 3 2.38 2.66 H 3 2.38 2.84 R 10 7.94 10.79 F 5 3.97 5.08 W 4 3.17 5.14 P 13 10.32 8.72 Charge Distribution (+/-) on the given sequence:
XXXX++++XXXXXXXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXX+X--XXXXX+XXXXXX-XXX-XXXX+X+X-XXXX--XXX++XXXXXX-XX+X-X-X
XX+XXX


With the sequence as reference:

XXXX++++XXXXXXXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXXXXXXXXXXXXXXX
MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY

XXXX+X--XXXXX+XXXXXX-XXX-XXXX+X+X-XXXX--XXX++XXXXXX-XX+X-X-X
HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN

XX+XXX
HNRTTT




The nature of the given sequence:

HPPPCCCCHHHHHHHPHHHPHPHHHHPPPPPCHPPHPHPHPPHHPHHPPHHHHHHPHPPP
PPHHCPCCPHHPHCPHPPHHCHHHCHHHHCHCHCPPHHCCHHHCCPPPPHHCHHCPCHCP
PPCPPP


With the sequence as reference:

HPPPCCCCHHHHHHHPHHHPHPHHHHPPPPPCHPPHPHPHPPHHPHHPPHHHHHHPHPPP
MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY

PPHHCPCCPHHPHCPHPPHHCHHHCHHHHCHCHCPPHHCCHHHCCPPPPHHCHHCPCHCP
HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN

PPCPPP
HNRTTT