PSATool output page

The sequence you entered is as below:

MRTELTPIEARVIGCLIEKEVTTPDQYPLSLNALTNACNQKSNREPVMSLSESEVLDAVD
QLISRRLVSDESGFNSRVSKYQHRFCNTEFGDLKLSAQEKGIVCCMLLRGPQTPGELRTR
TNRLATFADVKEVETVLDKLASEERGQLVVKLPIEPGKRESRYMHQFCGEVDLDAFQGSA
LMTASSTPQFDDERVAHLEAEVEALKQELAELKSLVNSLL

The Length of the aminoacid sequence is : 220 residues

The total molecular weight of the given sequence is : 24573.353 Daltons
Aminoacid Frequency %composition %wt composition G 10 4.55 2.32 A 15 6.82 4.34 V 17 7.73 6.85 L 28 12.73 12.89 I 6 2.73 2.76 S 18 8.18 6.38 T 13 5.91 5.35 Y 3 1.36 1.99 C 6 2.73 2.52 M 5 2.27 2.74 D 11 5.00 5.15 N 8 3.64 3.71 E 24 10.91 12.60 Q 11 5.00 5.73 K 11 5.00 5.73 H 3 1.36 1.67 R 15 6.82 9.53 F 7 3.18 4.19 W 0 0.00 0.00 P 9 4.09 3.55 Charge Distribution (+/-) on the given sequence:
X+X-XXXX-X+XXXXXX-+-XXXX-XXXXXXXXXXXXXXX+XX+-XXXXXX-X-XX-XX-
XXXX++XXX--XXXXX+XX+XXX+XXXX-XX-X+XXXX-+XXXXXXXX+XXXXXX-X+X+
XX+XXXXX-X+-X-XXX-+XXX--+XXXXX+XXX-XX++-X+XXXXXXX-X-X-XXXXXX
XXXXXXXXXX---+XXXX-X-X-XX+X-XX-X+XXXXXXX


With the sequence as reference:

X+X-XXXX-X+XXXXXX-+-XXXX-XXXXXXXXXXXXXXX+XX+-XXXXXX-X-XX-XX-
MRTELTPIEARVIGCLIEKEVTTPDQYPLSLNALTNACNQKSNREPVMSLSESEVLDAVD

XXXX++XXX--XXXXX+XX+XXX+XXXX-XX-X+XXXX-+XXXXXXXX+XXXXXX-X+X+
QLISRRLVSDESGFNSRVSKYQHRFCNTEFGDLKLSAQEKGIVCCMLLRGPQTPGELRTR

XX+XXXXX-X+-X-XXX-+XXX--+XXXXX+XXX-XX++-X+XXXXXXX-X-X-XXXXXX
TNRLATFADVKEVETVLDKLASEERGQLVVKLPIEPGKRESRYMHQFCGEVDLDAFQGSA

XXXXXXXXXX---+XXXX-X-X-XX+X-XX-X+XXXXXXX
LMTASSTPQFDDERVAHLEAEVEALKQELAELKSLVNSLL




The nature of the given sequence:

HCPCHPHHCHCHHHPHHCCCHPPHCPPHHPHPHHPPHPPPCPPCCHHHPHPCPCHHCHHC
PHHPCCHHPCCPHHPPCHPCPPPCHPPPCHHCHCHPHPCCHHHPPHHHCHHPPHHCHCPC
PPCHHPHHCHCCHCPHHCCHHPCCCHPHHHCHHHCHHCCCPCPHPPHPHCHCHCHHPHPH
HHPHPPPHPHCCCCHHPHCHCHCHHCPCHHCHCPHHPPHH


With the sequence as reference:

HCPCHPHHCHCHHHPHHCCCHPPHCPPHHPHPHHPPHPPPCPPCCHHHPHPCPCHHCHHC
MRTELTPIEARVIGCLIEKEVTTPDQYPLSLNALTNACNQKSNREPVMSLSESEVLDAVD

PHHPCCHHPCCPHHPPCHPCPPPCHPPPCHHCHCHPHPCCHHHPPHHHCHHPPHHCHCPC
QLISRRLVSDESGFNSRVSKYQHRFCNTEFGDLKLSAQEKGIVCCMLLRGPQTPGELRTR

PPCHHPHHCHCCHCPHHCCHHPCCCHPHHHCHHHCHHCCCPCPHPPHPHCHCHCHHPHPH
TNRLATFADVKEVETVLDKLASEERGQLVVKLPIEPGKRESRYMHQFCGEVDLDAFQGSA

HHPHPPPHPHCCCCHHPHCHCHCHHCPCHHCHCPHHPPHH
LMTASSTPQFDDERVAHLEAEVEALKQELAELKSLVNSLL