PSATool output page

The sequence you entered is as below:

MQNSLRIIVTIMACMFTGLISCKINENSERLIFDQSEQNGTVRLQTFVHGKISPEKNIQN
YEFTINQSENVRGNIQIDSTDPDLKVELIKKGFLFDSKKECTNTNLGNTYSCKIENQLLE
KGRYTAAVYKNTNTKKSDFNLFIGIFGKGYINVKATSNY

The Length of the aminoacid sequence is : 159 residues

The total molecular weight of the given sequence is : 18088.095 Daltons
Aminoacid Frequency %composition %wt composition G 10 6.29 3.15 A 4 2.52 1.57 V 7 4.40 3.83 L 11 6.92 6.88 I 16 10.06 10.00 S 11 6.92 5.29 T 13 8.18 7.26 Y 6 3.77 5.41 C 4 2.52 2.28 M 3 1.89 2.27 D 6 3.77 3.82 N 18 11.32 11.35 E 10 6.29 7.13 Q 8 5.03 5.66 K 15 9.43 10.62 H 1 0.63 0.76 R 5 3.14 4.32 F 9 5.66 7.32 W 0 0.00 0.00 P 2 1.26 1.07 Charge Distribution (+/-) on the given sequence:
XXXXX+XXXXXXXXXXXXXXXX+XX-XX-+XXX-XX-XXXXX+XXXXXXX+XXX-+XXXX
X-XXXXXX-XX+XXXXX-XX-X-X+X-XX++XXXX-X++-XXXXXXXXXXXX+X-XXXX-
+X+XXXXXX+XXXX++X-XXXXXXXXX+XXXXX+XXXXX


With the sequence as reference:

XXXXX+XXXXXXXXXXXXXXXX+XX-XX-+XXX-XX-XXXXX+XXXXXXX+XXX-+XXXX
MQNSLRIIVTIMACMFTGLISCKINENSERLIFDQSEQNGTVRLQTFVHGKISPEKNIQN

X-XXXXXX-XX+XXXXX-XX-X-X+X-XX++XXXX-X++-XXXXXXXXXXXX+X-XXXX-
YEFTINQSENVRGNIQIDSTDPDLKVELIKKGFLFDSKKECTNTNLGNTYSCKIENQLLE

+X+XXXXXX+XXXX++X-XXXXXXXXX+XXXXX+XXXXX
KGRYTAAVYKNTNTKKSDFNLFIGIFGKGYINVKATSNY




The nature of the given sequence:

HPPPHCHHHPHHHPHHPHHHPPCHPCPPCCHHHCPPCPPHPHCHPPHHPHCHPHCCPHPP
PCHPHPPPCPHCHPHPHCPPCHCHCHCHHCCHHHHCPCCCPPPPPHHPPPPPCHCPPHHC
CHCPPHHHPCPPPPCCPCHPHHHHHHHCHPHPHCHPPPP


With the sequence as reference:

HPPPHCHHHPHHHPHHPHHHPPCHPCPPCCHHHCPPCPPHPHCHPPHHPHCHPHCCPHPP
MQNSLRIIVTIMACMFTGLISCKINENSERLIFDQSEQNGTVRLQTFVHGKISPEKNIQN

PCHPHPPPCPHCHPHPHCPPCHCHCHCHHCCHHHHCPCCCPPPPPHHPPPPPCHCPPHHC
YEFTINQSENVRGNIQIDSTDPDLKVELIKKGFLFDSKKECTNTNLGNTYSCKIENQLLE

CHCPPHHHPCPPPPCCPCHPHHHHHHHCHPHPHCHPPPP
KGRYTAAVYKNTNTKKSDFNLFIGIFGKGYINVKATSNY