PSATool output page

The sequence you entered is as below:

MQLNKVLKGLLIALPVMAVTACSSSDDAASNAGTSTETNQTTSGSANTTDTTVVTPIDQN
GQLSEQELKEQALRETQTIYFAFDNATISSDYEEMLAAHAAYLSKNVNLKVTIEGHADER
GTPEYNIALGERRAQAVAKYLQALGVQADQIAIVSYGEEKPLLLGQTEEVYAKNRRAVLV
Y

The Length of the aminoacid sequence is : 181 residues

The total molecular weight of the given sequence is : 19534.765 Daltons
Aminoacid Frequency %composition %wt composition G 10 5.52 2.92 A 24 13.26 8.73 V 13 7.18 6.59 L 18 9.94 10.42 I 8 4.42 4.63 S 12 6.63 5.35 T 17 9.39 8.79 Y 8 4.42 6.68 C 1 0.55 0.53 M 3 1.66 2.10 D 8 4.42 4.71 N 10 5.52 5.84 E 15 8.29 9.91 Q 12 6.63 7.87 K 8 4.42 5.25 H 2 1.10 1.40 R 6 3.31 4.79 F 2 1.10 1.51 W 0 0.00 0.00 P 4 2.21 1.99 Charge Distribution (+/-) on the given sequence:
XXXX+XX+XXXXXXXXXXXXXXXXX--XXXXXXXXX-XXXXXXXXXXXX-XXXXXXX-XX
XXXX-X-X+-XXX+-XXXXXXXX-XXXXXX-X--XXXXXXXXXX+XXXX+XXX-XXX--+
XXX-XXXXXX-++XXXXX+XXXXXXXXX-XXXXXXXX--+XXXXXXX--XXX+X++XXXX
X


With the sequence as reference:

XXXX+XX+XXXXXXXXXXXXXXXXX--XXXXXXXXX-XXXXXXXXXXXX-XXXXXXX-XX
MQLNKVLKGLLIALPVMAVTACSSSDDAASNAGTSTETNQTTSGSANTTDTTVVTPIDQN

XXXX-X-X+-XXX+-XXXXXXXX-XXXXXX-X--XXXXXXXXXX+XXXX+XXX-XXX--+
GQLSEQELKEQALRETQTIYFAFDNATISSDYEEMLAAHAAYLSKNVNLKVTIEGHADER

XXX-XXXXXX-++XXXXX+XXXXXXXXX-XXXXXXXX--+XXXXXXX--XXX+X++XXXX
GTPEYNIALGERRAQAVAKYLQALGVQADQIAIVSYGEEKPLLLGQTEEVYAKNRRAVLV

X
Y




The nature of the given sequence:

HPHPCHHCHHHHHHHHHHHPHPPPPCCHHPPHHPPPCPPPPPPHPHPPPCPPHHPHHCPP
HPHPCPCHCCPHHCCPPPHPHHHCPHPHPPCPCCHHHHPHHPHPCPHPHCHPHCHPHCCC
HPHCPPHHHHCCCHPHHHCPHPHHHHPHCPHHHHPPHCCCHHHHHPPCCHPHCPCCHHHH
P


With the sequence as reference:

HPHPCHHCHHHHHHHHHHHPHPPPPCCHHPPHHPPPCPPPPPPHPHPPPCPPHHPHHCPP
MQLNKVLKGLLIALPVMAVTACSSSDDAASNAGTSTETNQTTSGSANTTDTTVVTPIDQN

HPHPCPCHCCPHHCCPPPHPHHHCPHPHPPCPCCHHHHPHHPHPCPHPHCHPHCHPHCCC
GQLSEQELKEQALRETQTIYFAFDNATISSDYEEMLAAHAAYLSKNVNLKVTIEGHADER

HPHCPPHHHHCCCHPHHHCPHPHHHHPHCPHHHHPPHCCCHHHHHPPCCHPHCPCCHHHH
GTPEYNIALGERRAQAVAKYLQALGVQADQIAIVSYGEEKPLLLGQTEEVYAKNRRAVLV

P
Y