PSATool output page

The sequence you entered is as below:

MPQDVQHGGKEMDLNAILLFVVACLAINMIPGPDVIYIVSNTMKGKLTTGFKAAIGLGVG
YFVHTLAACLGLSAIILSSAAAFSAVKWLGAAYLVYLGVQSLLSMWRGGSKIVVSESVET
NKNVFIQGVIVSVLNPKVALFFLSFLPQFVDKSAGSASMQLLVLGLLFSALATLCNVLYA
SVGSWVFSRSNSQRYSRALEGVSGVLLIGLAGKVAISER

The Length of the aminoacid sequence is : 219 residues

The total molecular weight of the given sequence is : 23080.324 Daltons
Aminoacid Frequency %composition %wt composition G 21 9.59 5.19 A 23 10.50 7.08 V 26 11.87 11.16 L 31 14.16 15.19 I 13 5.94 6.37 S 24 10.96 9.05 T 6 2.74 2.63 Y 6 2.74 4.24 C 3 1.37 1.34 M 6 2.74 3.48 D 4 1.83 1.99 N 8 3.65 3.95 E 5 2.28 2.80 Q 7 3.20 3.88 K 10 4.57 5.55 H 2 0.91 1.19 R 5 2.28 3.39 F 11 5.02 7.01 W 3 1.37 2.42 P 5 2.28 2.10 Charge Distribution (+/-) on the given sequence:
XXX-XXXXX+-X-XXXXXXXXXXXXXXXXXXXX-XXXXXXXXX+X+XXXXX+XXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXXXXXX+XXX+XXXX-XX-X
X+XXXXXXXXXXXXXX+XXXXXXXXXXXXX-+XXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXX+XXXX+XX+XX-XXXXXXXXXXXX+XXXX-+


With the sequence as reference:

XXX-XXXXX+-X-XXXXXXXXXXXXXXXXXXXX-XXXXXXXXX+X+XXXXX+XXXXXXXX
MPQDVQHGGKEMDLNAILLFVVACLAINMIPGPDVIYIVSNTMKGKLTTGFKAAIGLGVG

XXXXXXXXXXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXXXXXX+XXX+XXXX-XX-X
YFVHTLAACLGLSAIILSSAAAFSAVKWLGAAYLVYLGVQSLLSMWRGGSKIVVSESVET

X+XXXXXXXXXXXXXX+XXXXXXXXXXXXX-+XXXXXXXXXXXXXXXXXXXXXXXXXXXX
NKNVFIQGVIVSVLNPKVALFFLSFLPQFVDKSAGSASMQLLVLGLLFSALATLCNVLYA

XXXXXXXX+XXXX+XX+XX-XXXXXXXXXXXX+XXXX-+
SVGSWVFSRSNSQRYSRALEGVSGVLLIGLAGKVAISER




The nature of the given sequence:

HHPCHPPHHCCHCHPHHHHHHHHPHHHPHHHHHCHHPHHPPPHCHCHPPHHCHHHHHHHH
PHHPPHHHPHHHPHHHHPPHHHHPHHCPHHHHPHHPHHHPPHHPHPCHHPCHHHPCPHCP
PCPHHHPHHHHPHHPHCHHHHHHPHHHPHHCCPHHPHPHPHHHHHHHHPHHHPHPPHHPH
PHHPPHHPCPPPPCPPCHHCHHPHHHHHHHHHCHHHPCC


With the sequence as reference:

HHPCHPPHHCCHCHPHHHHHHHHPHHHPHHHHHCHHPHHPPPHCHCHPPHHCHHHHHHHH
MPQDVQHGGKEMDLNAILLFVVACLAINMIPGPDVIYIVSNTMKGKLTTGFKAAIGLGVG

PHHPPHHHPHHHPHHHHPPHHHHPHHCPHHHHPHHPHHHPPHHPHPCHHPCHHHPCPHCP
YFVHTLAACLGLSAIILSSAAAFSAVKWLGAAYLVYLGVQSLLSMWRGGSKIVVSESVET

PCPHHHPHHHHPHHPHCHHHHHHPHHHPHHCCPHHPHPHPHHHHHHHHPHHHPHPPHHPH
NKNVFIQGVIVSVLNPKVALFFLSFLPQFVDKSAGSASMQLLVLGLLFSALATLCNVLYA

PHHPPHHPCPPPPCPPCHHCHHPHHHHHHHHHCHHHPCC
SVGSWVFSRSNSQRYSRALEGVSGVLLIGLAGKVAISER