PSATool output page

The sequence you entered is as below:

MKKVAIITLSVLLSACASDNYVANVTTESHREEFKIEPIPEPLMAQEETVQEVSIPQQVV
KMEPQTEEKKVVKLSPQSETTKAVKIVPPSKKQQDKMQRFGYTVQVVAVGSQAKVDYFAS
KLPKDGQPIWENYKIVNGTKWFTVLYGDFATSTEAKKAIAQLPQEFKELQPFVKSIDAIK
NSEYPTLNKLN

The Length of the aminoacid sequence is : 191 residues

The total molecular weight of the given sequence is : 21479.182 Daltons
Aminoacid Frequency %composition %wt composition G 5 2.62 1.33 A 14 7.33 4.63 V 20 10.47 9.22 L 11 5.76 5.79 I 11 5.76 5.79 S 13 6.81 5.27 T 13 6.81 6.12 Y 6 3.14 4.56 C 1 0.52 0.48 M 4 2.09 2.52 D 6 3.14 3.21 N 7 3.66 3.72 E 17 8.90 10.21 Q 15 7.85 8.94 K 23 12.04 13.72 H 1 0.52 0.64 R 2 1.05 1.45 F 7 3.66 4.79 W 2 1.05 1.73 P 13 6.81 5.87 Charge Distribution (+/-) on the given sequence:
X++XXXXXXXXXXXXXXX-XXXXXXXX-XX+--X+X-XXX-XXXXX--XXX-XXXXXXXX
+X-XXX--++XX+XXXXX-XX+XX+XXXXX++XX-+XX+XXXXXXXXXXXXXX+X-XXXX
+XX+-XXXXX-XX+XXXXX+XXXXXXX-XXXXX-X++XXXXXXX-X+-XXXXX+XX-XX+
XX-XXXXX+XX


With the sequence as reference:

X++XXXXXXXXXXXXXXX-XXXXXXXX-XX+--X+X-XXX-XXXXX--XXX-XXXXXXXX
MKKVAIITLSVLLSACASDNYVANVTTESHREEFKIEPIPEPLMAQEETVQEVSIPQQVV

+X-XXX--++XX+XXXXX-XX+XX+XXXXX++XX-+XX+XXXXXXXXXXXXXX+X-XXXX
KMEPQTEEKKVVKLSPQSETTKAVKIVPPSKKQQDKMQRFGYTVQVVAVGSQAKVDYFAS

+XX+-XXXXX-XX+XXXXX+XXXXXXX-XXXXX-X++XXXXXXX-X+-XXXXX+XX-XX+
KLPKDGQPIWENYKIVNGTKWFTVLYGDFATSTEAKKAIAQLPQEFKELQPFVKSIDAIK

XX-XXXXX+XX
NSEYPTLNKLN




The nature of the given sequence:

HCCHHHHPHPHHHPHPHPCPPHHPHPPCPPCCCHCHCHHHCHHHHPCCPHPCHPHHPPHH
CHCHPPCCCCHHCHPHPPCPPCHHCHHHHPCCPPCCHPCHHPPHPHHHHHPPHCHCPHHP
CHHCCHPHHPCPPCHHPHPCPHPHHPHCHHPPPCHCCHHHPHHPCHCCHPHHHCPHCHHC
PPCPHPHPCHP


With the sequence as reference:

HCCHHHHPHPHHHPHPHPCPPHHPHPPCPPCCCHCHCHHHCHHHHPCCPHPCHPHHPPHH
MKKVAIITLSVLLSACASDNYVANVTTESHREEFKIEPIPEPLMAQEETVQEVSIPQQVV

CHCHPPCCCCHHCHPHPPCPPCHHCHHHHPCCPPCCHPCHHPPHPHHHHHPPHCHCPHHP
KMEPQTEEKKVVKLSPQSETTKAVKIVPPSKKQQDKMQRFGYTVQVVAVGSQAKVDYFAS

CHHCCHPHHPCPPCHHPHPCPHPHHPHCHHPPPCHCCHHHPHHPCHCCHPHHHCPHCHHC
KLPKDGQPIWENYKIVNGTKWFTVLYGDFATSTEAKKAIAQLPQEFKELQPFVKSIDAIK

PPCPHPHPCHP
NSEYPTLNKLN