PSATool output page

The sequence you entered is as below:

MKKHSISKIIITACCIFLLTYGCKQDPVDYNNKIMEIMNASTNDLDALNAAMEKEDLTNA
ENVRKAWETKLVSSLDKLKGISDFKGDSSFKNASVQALETYLNIVSKDYKRLIELRGLGD
KADSNEINQVLNRINQDFEKAANTLNAASDKFAKEYASQ

The Length of the aminoacid sequence is : 159 residues

The total molecular weight of the given sequence is : 17796.934 Daltons
Aminoacid Frequency %composition %wt composition G 5 3.14 1.60 A 16 10.06 6.39 V 6 3.77 3.34 L 15 9.43 9.53 I 12 7.55 7.62 S 13 8.18 6.36 T 7 4.40 3.97 Y 5 3.14 4.58 C 3 1.89 1.74 M 4 2.52 3.04 D 13 8.18 8.40 N 15 9.43 9.61 E 10 6.29 7.25 Q 5 3.14 3.60 K 18 11.32 12.96 H 1 0.63 0.77 R 4 2.52 3.51 F 5 3.14 4.13 W 1 0.63 1.05 P 1 0.63 0.55 Charge Distribution (+/-) on the given sequence:
X++XXXX+XXXXXXXXXXXXXXX+X-XX-XXX+XX-XXXXXXX-X-XXXXXX-+--XXXX
-XX++XX-X+XXXXX-+X+XXX-X+X-XXX+XXXXXXX-XXXXXXX+-X++XX-X+XXX-
+X-XX-XXXXXX+XXX-X-+XXXXXXXXX-+XX+-XXXX


With the sequence as reference:

X++XXXX+XXXXXXXXXXXXXXX+X-XX-XXX+XX-XXXXXXX-X-XXXXXX-+--XXXX
MKKHSISKIIITACCIFLLTYGCKQDPVDYNNKIMEIMNASTNDLDALNAAMEKEDLTNA

-XX++XX-X+XXXXX-+X+XXX-X+X-XXX+XXXXXXX-XXXXXXX+-X++XX-X+XXX-
ENVRKAWETKLVSSLDKLKGISDFKGDSSFKNASVQALETYLNIVSKDYKRLIELRGLGD

+X-XX-XXXXXX+XXX-X-+XXXXXXXXX-+XX+-XXXX
KADSNEINQVLNRINQDFEKAANTLNAASDKFAKEYASQ




The nature of the given sequence:

HCCPPHPCHHHPHPPHHHHPPHPCPCHHCPPPCHHCHHPHPPPCHCHHPHHHCCCCHPPH
CPHCCHPCPCHHPPHCCHCHHPCHCHCPPHCPHPHPHHCPPHPHHPCCPCCHHCHCHHHC
CHCPPCHPPHHPCHPPCHCCHHPPHPHHPCCHHCCPHPP


With the sequence as reference:

HCCPPHPCHHHPHPPHHHHPPHPCPCHHCPPPCHHCHHPHPPPCHCHHPHHHCCCCHPPH
MKKHSISKIIITACCIFLLTYGCKQDPVDYNNKIMEIMNASTNDLDALNAAMEKEDLTNA

CPHCCHPCPCHHPPHCCHCHHPCHCHCPPHCPHPHPHHCPPHPHHPCCPCCHHCHCHHHC
ENVRKAWETKLVSSLDKLKGISDFKGDSSFKNASVQALETYLNIVSKDYKRLIELRGLGD

CHCPPCHPPHHPCHPPCHCCHHPPHPHHPCCHHCCPHPP
KADSNEINQVLNRINQDFEKAANTLNAASDKFAKEYASQ