PSATool output page

The sequence you entered is as below:

MKFSIIKNLNLVLALLVLSSCKDDRIKISDLGVIDKDKKNQTAFVLQPEKLLVMVRTDSN
LDGKTDLWTWVRGDDKDPKTSLVLFEELIRKGNHSRTWYGPGNRKLIEQSDLDENGTWES
MVYYNAFAVPKETMRIVAHVEVDLYGKGKPSLWIFPEARMELDSNEDGKPDQILTNQDRM
LENFTQLQKGKQIQEKDFNPMPANSSWVLNPNQITNPRYQALIRQSLFPVN

The Length of the aminoacid sequence is : 231 residues

The total molecular weight of the given sequence is : 26624.602 Daltons
Aminoacid Frequency %composition %wt composition G 11 4.76 2.36 A 8 3.46 2.13 V 15 6.49 5.58 L 26 11.26 11.04 I 13 5.63 5.52 S 14 6.06 4.58 T 11 4.76 4.17 Y 5 2.16 3.06 C 1 0.43 0.39 M 7 3.03 3.51 D 19 8.23 8.21 N 17 7.36 7.29 E 13 5.63 6.30 Q 12 5.19 5.77 K 20 8.66 9.62 H 2 0.87 1.03 R 11 4.76 6.45 F 8 3.46 4.42 W 6 2.60 4.19 P 12 5.19 4.37 Charge Distribution (+/-) on the given sequence:
X+XXXX+XXXXXXXXXXXXXX+--+X+XX-XXXX-+-++XXXXXXXXX-+XXXXX+X-XX
X-X+X-XXXXX+X--+-X+XXXXXX--XX++XXXX+XXXXXXX++XX-XX-X--XXXX-X
XXXXXXXXXX+-XX+XXXXX-X-XXX+X+XXXXXXX-X+X-X-XX--X+X-XXXXXX-+X
X-XXXXXX+X+XXX-+-XXXXXXXXXXXXXXXXXXXX+XXXXX+XXXXXXX


With the sequence as reference:

X+XXXX+XXXXXXXXXXXXXX+--+X+XX-XXXX-+-++XXXXXXXXX-+XXXXX+X-XX
MKFSIIKNLNLVLALLVLSSCKDDRIKISDLGVIDKDKKNQTAFVLQPEKLLVMVRTDSN

X-X+X-XXXXX+X--+-X+XXXXXX--XX++XXXX+XXXXXXX++XX-XX-X--XXXX-X
LDGKTDLWTWVRGDDKDPKTSLVLFEELIRKGNHSRTWYGPGNRKLIEQSDLDENGTWES

XXXXXXXXXX+-XX+XXXXX-X-XXX+X+XXXXXXX-X+X-X-XX--X+X-XXXXXX-+X
MVYYNAFAVPKETMRIVAHVEVDLYGKGKPSLWIFPEARMELDSNEDGKPDQILTNQDRM

X-XXXXXX+X+XXX-+-XXXXXXXXXXXXXXXXXXXX+XXXXX+XXXXXXX
LENFTQLQKGKQIQEKDFNPMPANSSWVLNPNQITNPRYQALIRQSLFPVN




The nature of the given sequence:

HCHPHHCPHPHHHHHHHHPPPCCCCHCHPCHHHHCCCCCPPPHHHHPHCCHHHHHCPCPP
HCHCPCHPPPHCHCCCCHCPPHHHHCCHHCCHPPPCPPPHHHPCCHHCPPCHCCPHPPCP
HHPPPHHHHHCCPHCHHHPHCHCHPHCHCHPHPHHHCHCHCHCPPCCHCHCPHHPPPCCH
HCPHPPHPCHCPHPCCCHPHHHHPPPPHHPHPPHPPHCPPHHHCPPHHHHP


With the sequence as reference:

HCHPHHCPHPHHHHHHHHPPPCCCCHCHPCHHHHCCCCCPPPHHHHPHCCHHHHHCPCPP
MKFSIIKNLNLVLALLVLSSCKDDRIKISDLGVIDKDKKNQTAFVLQPEKLLVMVRTDSN

HCHCPCHPPPHCHCCCCHCPPHHHHCCHHCCHPPPCPPPHHHPCCHHCPPCHCCPHPPCP
LDGKTDLWTWVRGDDKDPKTSLVLFEELIRKGNHSRTWYGPGNRKLIEQSDLDENGTWES

HHPPPHHHHHCCPHCHHHPHCHCHPHCHCHPHPHHHCHCHCHCPPCCHCHCPHHPPPCCH
MVYYNAFAVPKETMRIVAHVEVDLYGKGKPSLWIFPEARMELDSNEDGKPDQILTNQDRM

HCPHPPHPCHCPHPCCCHPHHHHPPPPHHPHPPHPPHCPPHHHCPPHHHHP
LENFTQLQKGKQIQEKDFNPMPANSSWVLNPNQITNPRYQALIRQSLFPVN