PSATool output page

The sequence you entered is as below:

MISRLPRWVEFGAFLLALLAGCVNAIGLMGFQHQAISHLSGTVTLLGSSFLNGSSSTIHL
MLIVASFLIGSAFSGFFIESTALKLGRRYGVALCIEGFLLLMSLSFLINGNIYGQYLASA
ACGLQNAMITTFSGAVIRTTHMTGIITDLGIMIGESLRGQKFDKRKAKLFIFIFLGFLFG
GSAGALAFMHFNLYALAFPATFAVIIAISYWTLLYFSTPKQA

The Length of the aminoacid sequence is : 222 residues

The total molecular weight of the given sequence is : 23925.582 Daltons
Aminoacid Frequency %composition %wt composition G 24 10.81 5.72 A 24 10.81 7.13 V 7 3.15 2.90 L 33 14.86 15.60 I 21 9.46 9.93 S 20 9.01 7.28 T 13 5.86 5.49 Y 6 2.70 4.09 C 3 1.35 1.29 M 8 3.60 4.45 D 2 0.90 0.96 N 6 2.70 2.86 E 4 1.80 2.16 Q 6 2.70 3.21 K 6 2.70 3.21 H 5 2.25 2.86 R 7 3.15 4.57 F 22 9.91 13.52 W 2 0.90 1.56 P 3 1.35 1.22 Charge Distribution (+/-) on the given sequence:
XXX+XX+XX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXX-XXXX+XX++XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXX+XXXXXXXXX-XXXXXX-XX+XX+X-+++X+XXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX+XX


With the sequence as reference:

XXX+XX+XX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
MISRLPRWVEFGAFLLALLAGCVNAIGLMGFQHQAISHLSGTVTLLGSSFLNGSSSTIHL

XXXXXXXXXXXXXXXXXX-XXXX+XX++XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXX
MLIVASFLIGSAFSGFFIESTALKLGRRYGVALCIEGFLLLMSLSFLINGNIYGQYLASA

XXXXXXXXXXXXXXXXX+XXXXXXXXX-XXXXXX-XX+XX+X-+++X+XXXXXXXXXXXX
ACGLQNAMITTFSGAVIRTTHMTGIITDLGIMIGESLRGQKFDKRKAKLFIFIFLGFLFG

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX+XX
GSAGALAFMHFNLYALAFPATFAVIIAISYWTLLYFSTPKQA




The nature of the given sequence:

HHPCHHCPHCHHHHHHHHHHHPHPHHHHHHHPPPHHPPHPHPHPHHHPPHHPHPPPPHPH
HHHHHPHHHHPHHPHHHHCPPHHCHHCCPHHHHPHCHHHHHHPHPHHHPHPHPHPPHHPH
HPHHPPHHHPPHPHHHHCPPPHPHHHPCHHHHHHCPHCHPCHCCCCHCHHHHHHHHHHHH
HPHHHHHHHPHPHPHHHHHHPHHHHHHHPPPPHHPHPPHCPH


With the sequence as reference:

HHPCHHCPHCHHHHHHHHHHHPHPHHHHHHHPPPHHPPHPHPHPHHHPPHHPHPPPPHPH
MISRLPRWVEFGAFLLALLAGCVNAIGLMGFQHQAISHLSGTVTLLGSSFLNGSSSTIHL

HHHHHPHHHHPHHPHHHHCPPHHCHHCCPHHHHPHCHHHHHHPHPHHHPHPHPHPPHHPH
MLIVASFLIGSAFSGFFIESTALKLGRRYGVALCIEGFLLLMSLSFLINGNIYGQYLASA

HPHHPPHHHPPHPHHHHCPPPHPHHHPCHHHHHHCPHCHPCHCCCCHCHHHHHHHHHHHH
ACGLQNAMITTFSGAVIRTTHMTGIITDLGIMIGESLRGQKFDKRKAKLFIFIFLGFLFG

HPHHHHHHHPHPHPHHHHHHPHHHHHHHPPPPHHPHPPHCPH
GSAGALAFMHFNLYALAFPATFAVIIAISYWTLLYFSTPKQA