PSATool output page

The sequence you entered is as below:

MFWVGVRGCGGILLPDPAGGAKASERRLAGCRFSAPSTAPRPTFAVIDSSAILIPLRGHT
YLDFVQKNANAIAALLVLVVIGVAGRGALILVSTLGWFVAGEEPTLDQRDTVMKIPGRQ

The Length of the aminoacid sequence is : 119 residues

The total molecular weight of the given sequence is : 12490.684 Daltons
Aminoacid Frequency %composition %wt composition G 14 11.76 6.39 A 15 12.61 8.53 V 11 9.24 8.72 L 13 10.92 11.77 I 8 6.72 7.24 S 6 5.04 4.18 T 6 5.04 4.85 Y 1 0.84 1.31 C 2 1.68 1.65 M 2 1.68 2.23 D 5 4.20 4.60 N 2 1.68 1.83 E 3 2.52 3.10 Q 3 2.52 3.08 K 3 2.52 3.08 H 1 0.84 1.10 R 9 7.56 11.25 F 5 4.20 5.89 W 2 1.68 2.98 P 8 6.72 6.22 Charge Distribution (+/-) on the given sequence:
XXXXXX+XXXXXXXX-XXXXX+XX-++XXXX+XXXXXXXX+XXXXXX-XXXXXXXX+XXX
XX-XXX+XXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXX--XXX-X+-XXX+XXX+X


With the sequence as reference:

XXXXXX+XXXXXXXX-XXXXX+XX-++XXXX+XXXXXXXX+XXXXXX-XXXXXXXX+XXX
MFWVGVRGCGGILLPDPAGGAKASERRLAGCRFSAPSTAPRPTFAVIDSSAILIPLRGHT

XX-XXX+XXXXXXXXXXXXXXXXXX+XXXXXXXXXXXXXXX--XXX-X+-XXX+XXX+X
YLDFVQKNANAIAALLVLVVIGVAGRGALILVSTLGWFVAGEEPTLDQRDTVMKIPGRQ




The nature of the given sequence:

HHPHHHCHPHHHHHHCHHHHHCHPCCCHHHPCHPHHPPHHCHPHHHHCPPHHHHHHCHPP
PHCHHPCPHPHHHHHHHHHHHHHHHCHHHHHHPPHHPHHHHCCHPHCPCCPHHCHHHCP


With the sequence as reference:

HHPHHHCHPHHHHHHCHHHHHCHPCCCHHHPCHPHHPPHHCHPHHHHCPPHHHHHHCHPP
MFWVGVRGCGGILLPDPAGGAKASERRLAGCRFSAPSTAPRPTFAVIDSSAILIPLRGHT

PHCHHPCPHPHHHHHHHHHHHHHHHCHHHHHHPPHHPHHHHCCHPHCPCCPHHCHHHCP
YLDFVQKNANAIAALLVLVVIGVAGRGALILVSTLGWFVAGEEPTLDQRDTVMKIPGRQ