PSATool output page

The sequence you entered is as below:

MDCIMIEKRNYISILLIVILLALSGCKEKQPEQVEITDKYALPPNYTGSLNAVPYDFEYK
SPQWIGISARIEKFLGIQKTIYSGHCALLDLEKKTFSIRITGTKKDRVLRFLYLGNHRFA
LLNQENRGYIGKLDEDKREKIYEYNLYPLSEIMNEKKIDYTGPAPNERELTFSEIDGSKY
KSMNDCEQETIEQEKVQQSIDEEHERVKGDLAPP

The Length of the aminoacid sequence is : 214 residues

The total molecular weight of the given sequence is : 24838.608 Daltons
Aminoacid Frequency %composition %wt composition G 12 5.61 2.75 A 8 3.74 2.29 V 6 2.80 2.39 L 21 9.81 9.56 I 21 9.81 9.56 S 12 5.61 4.20 T 9 4.21 3.66 Y 13 6.07 8.53 C 4 1.87 1.66 M 4 1.87 2.18 D 12 5.61 5.56 N 10 4.67 4.59 E 23 10.75 11.95 Q 9 4.21 4.64 K 20 9.35 10.31 H 3 1.40 1.66 R 10 4.67 6.28 F 6 2.80 3.55 W 1 0.47 0.75 P 10 4.67 3.91 Charge Distribution (+/-) on the given sequence:
X-XXXX-++XXXXXXXXXXXXXXXXX+-+XX-XX-XX-+XXXXXXXXXXXXXXXX-X-X+
XXXXXXXXX+X-+XXXXX+XXXXXXXXXX-X-++XXXX+XXXX++-+XX+XXXXXXX+XX
XXXX-X+XXXX+X---++-+XX-XXXXXXX-XXX-++X-XXXXXXX-+-XXXX-X-XX+X
+XXX-X-X-XX-X-+XXXXX---X-+X+X-XXXX


With the sequence as reference:

X-XXXX-++XXXXXXXXXXXXXXXXX+-+XX-XX-XX-+XXXXXXXXXXXXXXXX-X-X+
MDCIMIEKRNYISILLIVILLALSGCKEKQPEQVEITDKYALPPNYTGSLNAVPYDFEYK

XXXXXXXXX+X-+XXXXX+XXXXXXXXXX-X-++XXXX+XXXX++-+XX+XXXXXXX+XX
SPQWIGISARIEKFLGIQKTIYSGHCALLDLEKKTFSIRITGTKKDRVLRFLYLGNHRFA

XXXX-X+XXXX+X---++-+XX-XXXXXXX-XXX-++X-XXXXXXX-+-XXXX-X-XX+X
LLNQENRGYIGKLDEDKREKIYEYNLYPLSEIMNEKKIDYTGPAPNERELTFSEIDGSKY

+XXX-X-X-XX-X-+XXXXX---X-+X+X-XXXX
KSMNDCEQETIEQEKVQQSIDEEHERVKGDLAPP




The nature of the given sequence:

HCPHHHCCCPPHPHHHHHHHHHHPHPCCCPHCPHCHPCCPHHHHPPPHPHPHHHPCHCPC
PHPPHHHPHCHCCHHHHPCPHPPHPPHHHCHCCCPHPHCHPHPCCCCHHCHHPHHPPCHH
HHPPCPCHPHHCHCCCCCCCHPCPPHPHHPCHHPCCCHCPPHHHHPCCCHPHPCHCHPCP
CPHPCPCPCPHCPCCHPPPHCCCPCCHCHCHHHH


With the sequence as reference:

HCPHHHCCCPPHPHHHHHHHHHHPHPCCCPHCPHCHPCCPHHHHPPPHPHPHHHPCHCPC
MDCIMIEKRNYISILLIVILLALSGCKEKQPEQVEITDKYALPPNYTGSLNAVPYDFEYK

PHPPHHHPHCHCCHHHHPCPHPPHPPHHHCHCCCPHPHCHPHPCCCCHHCHHPHHPPCHH
SPQWIGISARIEKFLGIQKTIYSGHCALLDLEKKTFSIRITGTKKDRVLRFLYLGNHRFA

HHPPCPCHPHHCHCCCCCCCHPCPPHPHHPCHHPCCCHCPPHHHHPCCCHPHPCHCHPCP
LLNQENRGYIGKLDEDKREKIYEYNLYPLSEIMNEKKIDYTGPAPNERELTFSEIDGSKY

CPHPCPCPCPHCPCCHPPPHCCCPCCHCHCHHHH
KSMNDCEQETIEQEKVQQSIDEEHERVKGDLAPP