BLASTP 2.2.16 [Mar-25-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference: Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. RID: 43RDG3XN015 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 4,902,867 sequences; 1,692,710,850 total letters Results of PSI-Blast iteration 2 Query= putative accessory gene regulator protein D [Listeria monocytogenes str. 4b F2365] Length=50 E-value BETTER than threshold Score E Sequences producing significant alignments: (Bits) Value gi|46906280|ref|YP_012669.1| accessory gene regulator protein... 69.7 4e-11 gi|16799121|ref|NP_469389.1| hypothetical protein lin0042 [Li... 68.2 1e-10 gi|116871462|ref|YP_848243.1| accessory gene regulator protei... 67.0 3e-10 gi|133731599|gb|EBA33297.1| hypothetical protein LMMG_01760 [Lis 65.1 9e-10 ALIGNMENTS Query 1 MNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVKMQEKNENK 50 46906280 1 MNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVKMQEKNENK 50 16799121 4 MNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVKMQEKNENK 53 116871462 4 MNKSVGKFLSRKLEEKSMKVADSSMSKACFMFVYEPKSPFVKMQEKNENK 53 133731599 4 MNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVKMQEKNE 51 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: May 8, 2007 6:00 PM Number of letters in database: 1,692,710,850 Number of sequences in database: 4,902,867 Lambda K H 0.312 0.123 0.329 Gapped Lambda K H 0.267 0.0390 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4902867 Number of Hits to DB: 5396676 Number of extensions: 96617 Number of successful extensions: 107 Number of sequences better than 10: 1 Number of HSP's better than 10 without gapping: 0 Number of HSP's gapped: 107 Number of HSP's successfully gapped: 1 Length of query: 50 Length of database: 1692710850 Length adjustment: 23 Effective length of query: 27 Effective length of database: 1579944909 Effective search space: 42658512543 Effective search space used: 42658512543 T: 11 A: 40 X1: 16 (7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (20.9 bits) S2: 71 (32.0 bits)