BLASTP 2.2.16 [Mar-25-2007]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman
(1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference: Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 43RF532R014


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,902,867 sequences; 1,692,710,850 total letters
Results of PSI-Blast iteration 2
Query=  BH3474 [Bacillus halodurans C-125]
Length=40


E-value BETTER than threshold                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|15616036|ref|NP_244341.1|  hypothetical protein BH3474 [Bac...  59.8    5e-08

ALIGNMENTS

Query     1   MKRTAKVISKATLGISKAFVNASSPLIYAPKIPNGLKKQK  40
15616036  1   MKRTAKVISKATLGISKAFVNASSPLIYAPKIPNGLKKQK  40


  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding
environmental samples from WGS projects
    Posted date:  May 8, 2007  6:00 PM
  Number of letters in database: 1,692,710,850
  Number of sequences in database:  4,902,867
Lambda     K      H
   0.313    0.127    0.338
Gapped
Lambda     K      H
   0.267   0.0403    0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4902867
Number of Hits to DB: 4488783
Number of extensions: 72719
Number of successful extensions: 108
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 108
Number of HSP's successfully gapped: 0
Length of query: 40
Length of database: 1692710850
Length adjustment: 14
Effective length of query: 26
Effective length of database: 1624070712
Effective search space: 42225838512
Effective search space used: 42225838512
T: 11
A: 40
X1: 16 (7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (20.8 bits)
S2: 71 (32.0 bits)