FBgn0052438 --- Smc5 (Smc5)

CG32438 CG7783 DmSMC5 SMC5 Smc5

CG32438-RB (992)

(0002113)2

MAGDRALSSKQLAGRIHSVYCKDFVSYSEITFHPKHYLNVLTGPNGSGKSTIVSAIILGLGGEPI LLDRSASVADYIQSNKTSATIIVRVYGRTPNTTETFRRIINSNGLSTFSVNDKDTSKKNFLAAVS SFNIQVSNLCQFLPQDRVQDFSKMNPQELLLNTMSSVCDEDLINSFNSLKQMRTEQANVHANREK EKSDLVKKQKRLEHLQMTVSQYKEREEVKQKLQVYSAKKLWVETQAGEAKAAEMKTQVKNAKTQS DKLKNQHDKLLQSQEQIEKEKESLRKALLEKQNIKKSRRTATECDNLNQLVENKIYELETLNKSR PLIVSELERAKESCAAARGKAMEQYSRRRQLEQKLNDEMIPEITAYKLKIERLRNVKMQKIDEIR AKNPNLVVAMNWLAQNKQRYKLNVYDPMILELTVQNHEDAKFLENVVAQRDLFAFACEDKGDMSD LINELCVKQKLGVNVIYCAPSDRLVYSPKTPIDDLRSFGFRSYLVDLVTGPIPLINKLCASYSIH NIPIGTEAVGNYTSSIPKAIRVYFGGSKKFVVTASRYRSDTILTESSIRAKNQLITVDSQQLALV MKQCSEAVKESDSIKNAITQTDNEFERLQAVAKDEQEKRRKLDQKIAHFNSLKTEIETLQKKLEA LRNSDSLDCLETNFCNSLHKDLKKIFDADAELCSCLKAIDRLIIEKNMAQTKVSIYMLQHETQIE ALKESEEQSKAATRDFQQLLQCLENQISDVNKRKSAIQGLCHGEIPTSSKFPFKKEFRELENIDL PELREAIHDFQARLECMKSVNSEAISSYQGLQNEVKQLEEGIQESVNQAKSIESGMSNLYDKWEP KLNSLVETISTKFSEFMESIEYVGEVVLSKTDKIMVQFRRGLQLQPLDKFIQSGGERAVSIAIYS LSLQHVTHVPFRCVDEINQGMDATNERHIFDLLLKEATKHGSAQYLFVTPKLLRDLNYNEHLCVS IVHNSKTVCHGMQFPMA


CG32438-RA (735)

(0005661)2

MAGDRALSSKQLAGRIHSVYCKDFVSYSEITFHPKHYLNVLTGPNGSGKSTIVSAIILGLGGEPI LLDRSASVADYIQSNKTSATIIVRVYGRTPNTTETFRRIINSNGLSTFSVNDKDTSKKNFLAAVS SFNIQVSNLCQFLPQDRVQDFSKMNPQELLLNTMSSVCDEDLINSFNSLKQMRTEQANVHANREK EKSDLVKKQKRLEHLQMTVSQYKEREEVKQKLQVYSAKKLWVETQAGEAKAAEMKTQVKNAKTQS DKLKNQHDKLLQSQEQIEKEKESLRKALLEKQNIKKSRRTATECDNLNQLVENKIYELETLNKSR PLIVSELERAKESCAAARGKAMEQYSRRRQLEQKLNDEMIPEITAYKLKIERLRNVKMQKIDEIR AKNPNLVVAMNWLAQNKQRYKLNVYDPMILELTVQNHEDAKFLENVVAQRDLFAFACEDKGDMSD LINELCVKQKLGVNVIYCAPSDRLVYSPKTPIDDLRSFGFRSYLVDLVTGPIPLINKLCASYSIH NIPIGTEAVGNYTSSIPKAIRVYFGGSKKFVVTASRYRSDTILTESSIRAKNQLITVDSQQLALV MKQCSEAVKESDSIKNAITQTDNEFERLQAVAKDEQEKRRKLDQKIAHFNSLKTEIETLQKKLEA LRNSDSLDCLETNFCNSLHKDLKKIFDADAELCSCLKAIDRLIIEKNMAQTKVSIYMLQHETQIE ALKESEEQSKAATVRKSKCT


CG32438-RD (1025)

(0002113)2

MAGDRALSSKQLAGRIHSVYCKDFVSYSEITFHPKHYLNVLTGPNGSGKSTIVSAIILGLGGEPI LLDRSASVADYIQSNKTSATIIVRVYGRTPNTTETFRRIINSNGLSTFSVNDKDTSKKNFLAAVS SFNIQVSNLCQFLPQDRVQDFSKMNPQELLLNTMSSVCDEDLINSFNSLKQMRTEQANVHANREK EKSDLVKKQKRLEHLQMTVSQYKEREEVKQKLQVYSAKKLWVETQAGEAKAAEMKTQVKNAKTQS DKLKNQHDKLLQSQEQIEKEKESLRKALLEKTRLLENAVAEKAAIDGKMDSLKQGIYQKKYELEQ NIKKSRRTATECDNLNQLVENKIYELETLNKSRPLIVSELERAKESCAAARGKAMEQYSRRRQLE QKLNDEMIPEITAYKLKIERLRNVKMQKIDEIRAKNPNLVVAMNWLAQNKQRYKLNVYDPMILEL TVQNHEDAKFLENVVAQRDLFAFACEDKGDMSDLINELCVKQKLGVNVIYCAPSDRLVYSPKTPI DDLRSFGFRSYLVDLVTGPIPLINKLCASYSIHNIPIGTEAVGNYTSSIPKAIRVYFGGSKKFVV TASRYRSDTILTESSIRAKNQLITVDSQQLALVMKQCSEAVKESDSIKNAITQTDNEFERLQAVA KDEQEKRRKLDQKIAHFNSLKTEIETLQKKLEALRNSDSLDCLETNFCNSLHKDLKKIFDADAEL CSCLKAIDRLIIEKNMAQTKVSIYMLQHETQIEALKESEEQSKAATRDFQQLLQCLENQISDVNK RKSAIQGLCHGEIPTSSKFPFKKEFRELENIDLPELREAIHDFQARLECMKSVNSEAISSYQGLQ NEVKQLEEGIQESVNQAKSIESGMSNLYDKWEPKLNSLVETISTKFSEFMESIEYVGEVVLSKTD KIMVQFRRGLQLQPLDKFIQSGGERAVSIAIYSLSLQHVTHVPFRCVDEINQGMDATNERHIFDL LLKEATKHGSAQYLFVTPKLLRDLNYNEHLCVSIVHNSKTVCHGMQFPMA


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 mitotic sister chromatid segregation G F
 condensin complex G F
 nucleic acid binding G F
 ATP binding G F
 nucleus G F
 mitosis G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database