FBgn0051611 --- His4:CG31611 (His4:CG31611)

CG31611 His4:CG31611

CG31611-RA (103)
(Histone)
(0006983)

MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleosome G F
 ** DNA binding G F
 nucleus G F
 nucleosome assembly G F
 chromosome organization and biogenesis (sensu Eukaryota) G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database