FBgn0039207 --- CG5789 (CG5789)

CG5789

CG5789-RA (1402)
(ABC_membran) (ABC_tran) (ABC_membran) (ABC_tran)
(0006089) (0003110)2 (0006089) (0003110)

MDSSAKPTRKNPRQHANIISQLIFAWAIPLLYRGSRRGLNTDDLTQCLKEDRSEQLGDRLEDQWF KELERSHRKKQKPHLRNALFRCFLGPTIINGLICFIYIVIKTLIPAVLAQLLIQFQKTPVAQLRN IDVNDISISDSLNRTARAIPNYVLSQAVANSSGSPGDALFPKSLDKAGPLEPIQPPVEEVDHNAT AVRSILDQTVEHMWNDMNSLGAVLVLSTLFCCFLLHHVDLRQRLMGARMRIACCSLIYRKTLRLS MKTAGQTPAGYLINLLSNDVNRLDYGFIFMHWIWIMPLQAMLTCYLIWLNIGIPAIVGVVGLLLK TVPVQTALSKVTSVLRMRIAERTDARVGIMNELVQGIQVIKMYAWEKPFQAVVAEARRSEIKQIR YASYLRGFYLSTMVFTERSTLYITLAAAALMGQTITADFVFSAASYYNILQLVAAIWYPLAVSFG AEALVSLRRIQDFLMLEGREERTQGLTHKRDQEGGDSRAVTIKDINASWDIEKPQKTLQSINLQI EKGQLCAVIGPVGAGKSSILQLLLGELPVIDGGVFIQGDLSYAAQEPWLFTGSVRNNILFGEEFD RKRYQEVTRCCALSTDFQQLPNGDKTLVGERGASLSGGQRARISLARAVYKPAQIYLMDDPLSAV DAHVGRHLFDEVIGPRGRLAQLKATRILVTHQVHFLSEADVIVIVDQGRILRQGTYQELINSDLD FARLLERPKEEEEGENSRNQTSPLSVNSLESDDEDIPFIDGVKDGYQQLRKQSSSVHGSKSLDST QLDDNVDEDDLAEAQASGGISPRVWYEYFHAGSTLLSFSFMVFVMVMSQVVCSSSDFFANIWTQQ EHQRSQGEATFSTFECMYIYGALIIAVVIMTTFRGFLFFKICMHASKVLHDRMFACILHATMRFF DTTPSGRILNRFSKDMGAIDELLPRAMMDFIQIALVMFGILIVIGILNPVLVAAMLVVAVVDVLI LKLYLRPSQDLKRLEGICRSPVFSHLSASLTGLAIIRSRQLQDVVAKEFDLLQDVHSSVWQLTMA VNTTLGLWLDCVSCIFLTSVTFSFIISSETTYSGNVGLAIAQAMILTGMVQYGVRQVAESLQQMT SVERVLQYTELEQEPALGEKTPPQQWPTRGQVEFRNMSCRYDPNGSPVLRNLNLTIEAGWKVGIV GRTGAGKSSLIGALFRLAHIEGEIFIDGIETGTISLEILRTRISIIPQDPVLFSATIRYNLDPFE RYTDAELWSALEDVELRKAIPGLDYMVTERGGNFSVGQRQLLCLARAILRNNKVLVLDEATANVD PQTDALIQRTIRIKFKQCTVLTVAHRLHTVMDSDRIIVMDAGVAVEFDVPYLLLKKSQGHLRQMV EATGGESEALKKTASDSHKRMQRERDERDRDQDESQE


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleotide binding G F
 ** DNA binding G F
 transporter activity G F
 ATP binding G F
 nucleus G F
 extracellular transport G F
 defense response G F
 xenobiotic-transporting ATPase activity G F
 response to toxin G F
 integral to membrane G F
 ATPase activity, coupled to transmembrane movement of substances G F
 ATP-binding cassette (ABC) transporter complex G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database