FBgn0038316 --- ()

FBgn0038316 CG6276

CG6276-RA (470)
(BESS)

MMTTDFAGSQFVSSNPNTSCSASRWLTEEVFKLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVD LKLEKNPGASLAKWTNLRISFRREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPKSLDTQVQ DALAHLSNLSSRMQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIM EEEQQRNSRYHGQLDGNDIKSECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSSSSSAEAQRRY ANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAVAGVNYSAQPTAHPNISFVRPTFS KPVDLVSTTTHAGGGGGGGVPGTAGLSEAELPTPSTAAVATPMAPSSSVSASSSSSYLSQRHGHN HMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNGRDRGKI KIAFQNILQDYLYPD


maybe DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
The entire gene is molecularly uncharacterised, but exhibits a DBD DNA binding domain
DBD yes
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database