FBgn0038046 --- CG5641 (CG5641)

CG5641

CG5641-RA (396)
(DZF)

MVRGALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDDSALTAALLKRNQDLS PTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQLEEVRQVGSFKKGTILTGNNVADVVVILKTL PTKEAVDALAKKVEADLKASMKTEVLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLE PEIHLDHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAI MNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEPGHIRVHTAMTLEQQDVCCYTSQTLL RVLAHGGYKHILGLEGNTSVVREMSVWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEG SDDGAE


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
GO:0003677 from electronic annotation
RNA binding
 ** DNA binding G
 ** RNA polymerase II transcription factor activity G
 ** transcription cofactor activity G F
 double-stranded RNA binding G
 mRNA binding G F
 protein binding G
 ATP binding G F
 nucleus G
 nucleolus G
 defense response G F
 immune response G F
 transferase activity G F
 ** transcription regulator activity G F
 ** transcription regulator activity G
 ** positive regulation of transcription, DNA-dependent G
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database