FBgn0037301 --- Mms19 (Mms19)

CG12005 Mms19 NEST:bs07f08 dMMS19

CG12005-RB (959)

(0004276) (0000609)3 (0004276) (0000609)2 (0004276)

MTTPTRATLEKALKSDQKLVNSATQIAKDLTAKAYDISALAEALGFALSSPDMEERVAGTNLLSA VLIALPQDLLQERQLEFLSTFYMDRLRDHHNVMPAIIDGIDALVHMKALPRAQIPQILQSFFEHT TCQSQTRSDRTKLFHIFQYLTENFQDELQAMAGDFVYGLINSIDGERDPRNLDIIFSFMPEFLST YPLLHLAEEMFEIFACYFPIDFNPSKQDPAAITRDELSKKLTNCLVANNEFAEGTVVLAIEKLES ELLVAKLDSIELLHQAAVKFPPSVLEPHFDQIWQALKTETFPGNDNEEILKASLKALSALLERAA HIPDISHSYQSSILGVILPHLSDVNQRLFHPATGIALVCVSGDAPYAADKILNSFLLKLQAADAS SEQRIKIYYIVSQVYKLSALRGSLQKLDTTIRESVQDDVIASLRLIEQEEFDAKKEDLELQKAAL SVLNESAPLLNEKQRALIYKALVQLVSHPSIDIDFTTLTVSLGALQPVEVQSNFIDVCVRNFEIF STFVKRKIYTNLLPLMPQIAFTQRILDLVMTQTFNDTTAEPVRLLALEALNKLLLLADQRFIVDV QQESNLLHKLIELGQKTEGLSMQSLEQIAGALSRITQQLPLSEQSAIVSEYLPGLNLSQSADLYI TKGLLGYLHKDITLDDHFERLLTDLTQLSLNSDNEQLRVIAHHLLCSMVNKMESNPANLRKVKKI TEQLKVAIKKGDVRAVEILAWVGKGLVVAGFDEAADVVGDLSDLLKHPSLSTAAALGFDIIAAEY PELDLPVVKFLYKQKLFHTIMGKMGSKLANYCVHHLKAFVYVLKATPQAVIKLNIEQLGPLLFKS LEEHNEAQSLCIALGICEKFVAQQDTYFQGHLAHLIPSCLELSKYKAQHTMQVRIAALQLLYDVT KYPTFVLLPHKVDVTLALAAALDDPKRLVRNTAVKARNAWYLVGAPSPN


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleic acid binding G F
 ** transcription cofactor activity G F
 DNA repair G F
 ** regulation of transcription from RNA polymerase II promoter G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database