FBgn0032634 --- Rpb11 (Rpb11)

BcDNA:GM15177 CG6840 RPB11 Rpb11

CG6840-RA (117)
(RNA_pol_L)
(0006329)

MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEGGD


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleic acid binding G F
 ** DNA binding G F
 DNA-directed RNA polymerase activity G F P
 DNA-directed RNA polymerase activity G F
 nucleus G F
 DNA-directed RNA polymerase II, core complex G F P
 ** transcription G F
 ** transcription from RNA polymerase II promoter G F P
 ** mRNA transcription G F
 protein dimerization activity G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database