FBgn0032525 --- CG16954 (CG16954)

CG16954

CG16954-RA (558)
(Cpn60_TCP1)
(0003973) (0003974) (0003631) (0003974) (0003973)

MLSRLGRSGRAGVRTFANDIRFGAEARCLLMQGVNVLANAVATTLGPKGRNVLIEQLLISPRITK DGITVANNVQLGNRRQDMGVQLLRQATNNTNNKVGDGTTTATILARGIACQGMHVLRQSKVNVQL LREGILEGSRAVCDALGEMSQSVDTIGQVEAVAKVALNGDERLAELIGDIILELGDSGVILLKES HSPFDEAKIQEGITIASGYYSPFFAKQSHTLELENCLLLLTLAKIDQVEQILPALELARLKERPL LIIAKNFGSDLLKILVLNNLQGRVQVCAVKAPSFGDEQCEEMEDIAFATGGHLLEDASSLADLSE EDLGEVMEAVVDAKETHLLQPINVNEEQVQCRIQDIRELIDEAFTDVELDRLKTRLGRLQGHLAT IFVGGTSELEVSERKDRFNDALHAVRVAISDGVVPGGGTAYLRCIPVLDELPPTDIMELQVGREI VKDALRLPCYTIARNAGVDPNEVLRRVLKGSGNYGYDAAAGEFGDLVVRGIVDPTKVLQSAMTSA AGIASLLATTEVLITKQPTKPKIPKNQVTKDLAKLVGM


CG16954-RB (558)
(Cpn60_TCP1)
(0003973) (0003974) (0003631) (0003974) (0003973)

MLSRLGRSGRAGVRTFANDIRFGAEARCLLMQGVNVLANAVATTLGPKGRNVLIEQLLISPRITK DGITVANNVQLGNRRQDMGVQLLRQATNNTNNKVGDGTTTATILARGIACQGMHVLRQSKVNVQL LREGILEGSRAVCDALGEMSQSVDTIGQVEAVAKVALNGDERLAELIGDIILELGDSGVILLKES HSPFDEAKIQEGITIASGYYSPFFAKQSHTLELENCLLLLTLAKIDQVEQILPALELARLKERPL LIIAKNFGSDLLKILVLNNLQGRVQVCAVKAPSFGDEQCEEMEDIAFATGGHLLEDASSLADLSE EDLGEVMEAVVDAKETHLLQPINVNEEQVQCRIQDIRELIDEAFTDVELDRLKTRLGRLQGHLAT IFVGGTSELEVSERKDRFNDALHAVRVAISDGVVPGGGTAYLRCIPVLDELPPTDIMELQVGREI VKDALRLPCYTIARNAGVDPNEVLRRVLKGSGNYGYDAAAGEFGDLVVRGIVDPTKVLQSAMTSA AGIASLLATTEVLITKQPTKPKIPKNQVTKDLAKLVGM


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
GO:0003700 inferred by electronic annotation, and I cannot find evidence for both DNA binding nor transcriptional regulation
HTH_Fis, DNA binding, InterPro Record, no further references
 ** transcription factor activity G F
 ATP binding G F
 mitochondrial matrix G F
 mitochondrial matrix G F
 ** regulation of transcription, DNA-dependent G F
 'de novo' protein folding G F
 protein targeting to mitochondrion G F
 response to heat G F
 ATPase activity, coupled G F
 unfolded protein binding G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database