FBgn0027903 --- CG12018 (CG12018)

BcDNA:HL03874 CG12018

CG12018-RA (431)
(DNA_pol_alp)

MTNRLETKYENLSSIFRLKGHDYQKQFFHLYAHRLAEMTRLLTPLAQKKWGNKEPIKKLCELRGE QDVHCILIGTIFKHQAHKPSILRDISEENQLAPQPPRQNYSDPEDKIVLEDELQRVRLQGKLNGQ LLATGVVCAALGGTDSDGFFNVEDILFYESGPQKPLAPIKRSRLLVLASGLDQLQAHKFVEALNL FQYWLAGSLGNNKEAGSMVRLIVAGNSVRASAMAHVPTLQVARTQANANDTVQAVSQLDQWFASW ARSLPVDIMPGPYDPANFMLPQQPFHKCMFPQAAQLATFQAVTNPYSCRLDEALVVGTSGQNVSD LLRSTSLDSALEALRCTLTWGHVAPTAPDTLACYPYIESDPFILRECPHVYYAGNCESFATELHE GSEGKRTRLVCVPSFSKTQSVAVVDLDTLDCRMVNFSVDAE


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleic acid binding G F
 delta DNA polymerase activity G F
 delta DNA polymerase activity G F
 nucleus G F
 delta DNA polymerase complex G F
 delta DNA polymerase complex G F
 DNA replication G F
 DNA repair G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database