FBgn0027378 --- MRG15 (MRG15)

CG6363 DmMRG15 Dmrg15 MRG15 dMRG15 l(3)j6A3

CG6363-RA (424)
(MRG)

MGEVKPAKVENYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWD EWVPENRVLKYNDDNVKRRQELARQCGERSKKDNKKGSAKAKKMEQMRNESRASTPSKDSNTSQS TASSTPTTSAGPGSKSEAGSTGTTTTNSTANSTTSRAHRKSTQSTPSTARPGTPSDKKEDPAAAE TTEEEGPVAPKKKRMSEQRPSLTGSDVAEKPLPPTTTPSTPTTEPAPCVESEEAYAAKVEVKIKI PDELKHYLTDDWYAVVREHKLLELPAKVTVQQISEQYLAHKKSVKSTSASKEVAINDVLDGIVEY FNVMLGSQLLYKFERTQYADVMQKHPDTPLSELYGSFHLLRLFVRLGSMLSYSALDQQSMQNLLT HVQDFLKFLVKNSSIFFSMSNFINVDPEYVRNAQ


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleus G F
 nucleus G F
 ** regulation of transcription from RNA polymerase II promoter G F
 ** transcription regulator activity G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database