FBgn0026876 --- CG11403 (CG11403)

CG11403 EG:33C11.2 cg11403

CG11403-RA (861)
(DEAD_2)
(0007069) (0001640)3 (0007069)

MSQYTPNQRLDTPGAQEFGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALT WLARHEELVRTEMLARIRGVEQELAKLKEESEQSSNWLESQGKSRAQRAELLRLQHLQALLDKQE QQLDQIRKGAKKHKRQGRVHPGKLEELEKDLDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSR THSQLAQIVAELRKTPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSK KSRLTAEANSRCPFKAASLVESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLP YQLLLQKSARNQLGISLKGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKVQISGYKDHFQKRF TTKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCARTRFA RKVQGRADRMEREPRPSENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQE QQKPTKKPVEEVAPSPIRPLLAFLETLTSNAEDGRILVDPVGGTLKYILLDPAEQFADIVAEARA IVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAE MLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGSAEQLLD NYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLG PGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEANAANG GFGAVQGRTARFFKGR


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleic acid binding G F
 nucleic acid binding G F
 ** DNA binding G F
 ATP-dependent DNA helicase activity G F
 helicase activity G F P
 ATP binding G F
 nucleus G F
 nucleotide-excision repair G F
 chromosome segregation G F
 mitosis G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database