FBgn0022238 --- lolal (lola like)

25/12 Ban CG5738 EP0647 EP647 anon-EST:fe3D3 anon-WO0172774.186 l(2)k02512 l(2)kO2512 lolal

CG5738-RB (127)
(BTB)
(0001007)

MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG

CG5738-RC (127)
(BTB)
(0001007)

MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG

CG5738-RA (127)
(BTB)
(0001007)

MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG

CG5738-RD (127)
(BTB)
(0001007)

MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG

NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
YES putative short-range transcription factor
known or putative long-range transcription factor
No DNA binding domains.
We identified lola like, aka batman, as a strong interactor of GAGA factor in a yeast two-hybrid screen. lolal also interacts with polyhomeotic and, like Trl, both lolal and ph are needed for iab-7PRE mediated pairing dependent silencing of mini-white transgene. These observations suggest a possible mechanism of how Trl-GAGA plays a role in maintaining the repressed state of target genes involving lolal, which may function as a mediator to recruit PcG complexes.P
 ** specific RNA polymerase II transcription factor activity G F P
 protein binding G F P
 nucleus G F P
 chromatin assembly or disassembly G F
 ** regulation of transcription from RNA polymerase II promoter G F P
 sex determination G F
 transmission of nerve impulse G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database