FBgn0020238 --- 14-3-3&egr; ()

14-3-3 14-3-3&egr; 14-3-3-e 14-3-3e 14-3-3epsilon CG31196 CT24092 D14-3-3&egr; D14-3-3e EK3-5 PAR5 Par-5 SR3-9 Su(Raf)3B anon-WO0172774.141 anon-WO02059370.52 d14-3-3&egr; l(3)j2B10 par-5

CG31196-RC (256)
(14-3-3)
(0004317)

MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHR YLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLA KAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEGDGEPKEQIQDVEDQDVS


CG31196-RD (260)
(14-3-3)
(0004317)

MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHR YLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLA KAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEDPNAGDGEPKEQIQDVEDQDVS


CG31196-RB (261)
(14-3-3)
(0004317)

MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHR YLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLA KAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEVDPNAGDGEPKEQIQDVEDQDV S


CG31196-RA (262)
(14-3-3)
(0004317)

MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHR YLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLA KAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVEDQD VS


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 DNA damage checkpoint G F P
 DNA damage checkpoint G F P
 DNA damage checkpoint G F P
 diacylglycerol-activated phospholipid-dependent protein kinase C inhibitor activity G F
 nucleus G F P
 chromosome G F P
 cytoplasm G F P
 regulation of mitosis G F P
 mitotic checkpoint G F P
 Ras protein signal transduction G F
 Ras protein signal transduction G F
 imaginal disc development G F P
 response to radiation G F P
 response to external stimulus G F
 maintenance of oocyte identity (sensu Insecta) G F P
 protein domain specific binding G F
 ** transcription regulator activity G F
 ring canal (sensu Insecta) G F P
 nonassociative learning G F
 oocyte microtubule cytoskeleton polarization (sensu Insecta) G F P
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database