FBgn0019828 --- dj (don juan)

CG1980 DJ bs02h03.y1 dj

CG1980-RA (248)

MFKRTALILRRCFQPTFIRPHHINVLENFKEADDLPNQGQAKFVDVSIHDPQHIRSALVSPMQRK FLQDLEQQQTVRIKWFKEGNQDELENMKNECRRLALEIIMAAKGGDIKKACKELAEKEKCKQIEL KKKCKELEKKTKCAKKDPCKKKDPCKKKDPCKKKDPCKKKDPCKKKDPCKKKDPCKKKDPCKKKG GDLKKKCKKLAEKEKCKKLAKKEKMKKLQKKCKKMAQKEKCKKMAKKDKCKKK


CG1980-RB (218)

MSLRTLRKGQAKFVDVSIHDPQHIRSALVSPMQRKFLQDLEQQQTVRIKWFKEGNQDELENMKNE CRRLALEIIMAAKGGDIKKACKELAEKEKCKQIELKKKCKELEKKTKCAKKDPCKKKDPCKKKDP CKKKDPCKKKDPCKKKDPCKKKDPCKKKDPCKKKGGDLKKKCKKLAEKEKCKKLAKKEKMKKLQK KCKKMAQKEKCKKMAKKDKCKKK


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 ** DNA binding G F
 nucleus G F P
 nucleus G F
 mitochondrion G F
 spermatogenesis G F P
 spermatid development G F
 sperm individualization G F P
 flagellum (sensu Eukaryota) G F P
 mitochondrial derivative G F P
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database