FBgn0016685 --- Nlp (Nucleoplasmin)

CG7917 CRP1 Crp1 Nlp dNLP dNLP-S p22

CG7917-RA (152)
(Nucleoplasm)
(0006890)

MAEESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIA VLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEDDEEDDVAEDEEDEH PKKRAKIENAADGKNAKNNKKK


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleic acid binding G F
 nucleus G F
 nucleus G F
 nucleolus G F
 nucleosome spacing G F
 histone binding G F P
 histone binding G F
 ATPase activity, coupled G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database