FBgn0015844 --- Xpd (Xeroderma pigmentosum D)

CG9433 DhR3 DhXPD DmXPD XPD XPD/ERCC2 Xpd

CG9433-RB (745)
(DEAD_2) (DUF1227)
(0001151) (0001640) (0001151) (0001640)

MLELKRSLDAKGHCLLEMPSGTGKTATLLSLIVAYMVEHPETVRKLIYCSRTVPEIEKVIAELQN LMVYYERHCPNPPPFTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTETPI CQYFEGFSLEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIAHAHIVVYSYHYLLDPKIAQ VVSKEMSRESCVVFDEAHNIDNVCIDSMSVKINRRTVERSTNALNHLTKLVQDIREEDTNRLNEE YQRMVQGLKDASVQRDTDMILANPVLPNDVLTEVVPGNIRNADHFLSFLRRFIEYIKTRLRVHHV VQESPAGFLKDISSKICIERKPLRFCAERLSSLLRTLEISDLTEYGALTLITHFATLVSTYTKGF TIIIEPFDDKTPTVSNPILHFSCLDSSIAMAPVFSRFQTVVITSGTLSPMDMYPKILDFDPVVMS SFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNYGQLLVEVAKTVPDGIVCFFTSYLY LESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYALMNYVKACDCGRGAVLLAVARGKVSEGVD FDHHYGRAVLMFGIPYVYTQSRILKARLDYLRDQFQIRENDFLTFDAMRHAAQCVGRALRGKTDY GIMIFADKRFSRHDKRSRLPKWIQEHLVDSFCNLSTEEAVQLARRWLRRMAQPFTREDQLGISLL TLAQLENMEQEKLERQAQGKQGVGGEVQEL


CG9433-RA (769)
(DEAD_2) (DUF1227)
(0001151) (0001640) (0001151) (0001640)

MKLSVDGLLVYFPYEYIYPEQYAYMLELKRSLDAKGHCLLEMPSGTGKTATLLSLIVAYMVEHPE TVRKLIYCSRTVPEIEKVIAELQNLMVYYERHCPNPPPFTGLVLSSRKNMCIHPEVSKEREGKAV DGKCYGLTASYIRERHEMDTETPICQYFEGFSLEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLA RYAIAHAHIVVYSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNIDNVCIDSMSVKINRRTVERST NALNHLTKLVQDIREEDTNRLNEEYQRMVQGLKDASVQRDTDMILANPVLPNDVLTEVVPGNIRN ADHFLSFLRRFIEYIKTRLRVHHVVQESPAGFLKDISSKICIERKPLRFCAERLSSLLRTLEISD LTEYGALTLITHFATLVSTYTKGFTIIIEPFDDKTPTVSNPILHFSCLDSSIAMAPVFSRFQTVV ITSGTLSPMDMYPKILDFDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNY GQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYALMNYV KACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYLRDQFQIREND FLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSRLPKWIQEHLVDSFCNLSTEEAVQ LARRWLRRMAQPFTREDQLGISLLTLAQLENMEQEKLERQAQGKQGVGGEVQEL


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
basal transcription factor TFIIH
UV-light irradiation of third-instar larvae induces an increase in the signal intensity and in the number of sites where the DmXPD protein is located in polytene chromosomes, indicating that the DmXPD protein is recruited intensively in the chromosomes as a response to DNA damage. This is the first time that the response to DNA damage by UV-light irradiation can be visualized directly on the chromosomes using one of the TFIIH components. P
 nucleic acid binding G F
 nucleic acid binding G F
 ** DNA binding G F
 DNA helicase activity G F
 ATP-dependent DNA helicase activity G F
 helicase activity G F P
 ATP binding G F
 nucleus G F P
 ** transcription factor TFIIH complex G F P
 ** transcription factor TFIIH complex G F P
 polytene chromosome puff G F P
 polytene chromosome interband G F P
 cytoplasm G F P
 nucleotide-excision repair G F P
 ** transcription initiation from RNA polymerase II promoter G F P
 chromosome segregation G F
 regulation of mitosis G F P
 ATP-dependent helicase activity G F
 ** general RNA polymerase II transcription factor activity G F P
 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides G F
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database