FBgn0002733 --- HLHm&bgr; (E(spl) region transcript m&bgr;)

CG14548 Dm-mA E(Spl) HLH-Mbeta E(spl) E(spl) mbeta E(spl)&bgr; E(spl)-M&bgr; E(spl)M&bgr; E(spl)m&bgr; E(spl)mA E(spl)mbeta HLH-m&bgr; HLHm&bgr; HLHmA HLHmbeta M&bgr; m&bgr; mA mbeta

CG14548-RA (195) (HLH) (Hairy_orang) (0003356) MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVE HMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMS HLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW

YES	DNA binding (if we think it is a transcription factor)
YES	site-specific transcription factor
	putative short-range transcription factor
	known or putative long-range transcription factor

not annotated GO:0003677; a TF on www.flyreg.org

Between 20 and 40 oligonucleotides selected by M3, M, and M were sequenced, and a comparison between them established clear consensus binding sites (Fig. 1A and B). All three proteins selected very similar DNA sequences, consistent with the observation that their basic domains differ by only one amino acid residue. The three sets of sequences can be combined to give a palindromic 12-bp consensus sequence (5'-TGGCACGTG[C/T][C/T]A-3') which we have called the ESE box [E(spl) E box]. The core of the ESE box, 5'-CACGTG-3', is a canonical E box of the class B type, according to the classification system of Dang et al. (10). P

 ** negative regulation of transcription from RNA polymerase II promoter G F

---

 ** DNA binding G F

---

 ** DNA binding G F

---

 ** transcription factor activity G F P

---

 nucleus G F

---

 nucleus G F

---

 ** regulation of transcription from RNA polymerase II promoter G F

---

 Notch signaling pathway G F

---

 ectoderm development G F

---

 nervous system development G F

---

 eye development (sensu Endopterygota) G F P

---

 cell proliferation G F

---

 ** negative regulation of transcription G F

---

 ** transcriptional repressor activity G F

---

 ** specific transcriptional repressor activity G F

---

DBD yes / FlyReg TF / FlyMine TF

Comment

Database entries

Meaningful phrase

Curator's verdict

Protein information

GO annotation (legend)

www.FlyTF.org - The Drosophila Transcription Factor Database