FBgn0001965 --- Sos (Son of sevenless)

2.3 34Ea BG:DS00941.4 CG7793 E(sev)2A E(var)189 EK2-8 EY2-3 SOS Sos Sos1 Su(tor)2-2 br24 br25 dSos dme-SOS l(2)34Ea l(2)Sos l(2)br24 l(2)br25 l(2)k05224 l(2)k06321 sos

CG7793-RA (1596)
(Histone) (RhoGEF) (PH) (RasGEF_N) (RasGEF)
(0002649) (0001659) (0007941) (0000879)2

MFSGPSGHAHTISYGGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAGLQDCDGYDFTKCEN AARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSFP APIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAVLEYISADILKMA GDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQRASATYEETVKELIHDE KQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQSAPCVG SCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLSKPGASSLTTAGHGFRDAVKYYLPKLLLVP ICHAFVYFDYIKHLKDLSSSQDDIESFEQVQGLLHPLHCDLEKVMASLSKERQVPVSGRVRRQLA IERTRELQMKVEHWEDKDVGQNCNEFIREDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQT PSAGATAYDYRLKEKYFMRRVDINDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLM VITKSMLDRHLDSILQDIERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLI ERLTYHIYADPTFVRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGTAGAGGMGGVGGDK EHKNSHREDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKW VDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEMY KNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMMV MLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKKYQERLRSINPPC VPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEESTIRQFFEQ LDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQTNSSSKLSNS TSSVAAAAAASSTATSIATASAPSLHASSIMDAPTAAAANAGSGTLAGEQSPQHNPHAFSVFAPV IIPERNTSSWSGTPQHTRTDQNNGEVSVPAPHLPKKPGAHVWANNNSTLASASAMDVVFSPALPE HLPPQSLPDSNPFASDTEAPPSPLPKLVVSPRHETGNRSPFHGRMQNSPTHSTASTVTLTGMSTS GGEEFCAGGFYFNSAHQGQPGAVPISPHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQ APDAPTLPPRDGELSPPPIPPRLNHSTGISYLRQSHGKSKEFVGNSSLLLPNTSSIMIRRNSAIE KRAAATSQPNQAAAGPISTTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSH PVESTSSSYAHQLRMRQQQQQQTHPAIYSQHHQHHATHLPHHPHQHHSNPTQSRSSPKEFFPIAT SLEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNEE


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 nucleosome G F
 ** DNA binding G F
 Ras guanyl-nucleotide exchange factor activity G F
 Ras guanyl-nucleotide exchange factor activity G F
 Ras guanyl-nucleotide exchange factor activity G F
 protein binding G F P
 nucleus G F
 nucleosome assembly G F
 chromosome organization and biogenesis (sensu Eukaryota) G F
 actin filament organization G F P
 G-protein coupled receptor protein signaling pathway G F
 Ras protein signal transduction G F
 nervous system development G F
 torso signaling pathway G F P
 regulation of cell shape G F P
 determination of anterior/posterior axis, embryo G F P
 sevenless signaling pathway G F P
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database