FBgn0001222 --- Hsf (Heat shock factor)

CG5748 D-HSF Dm-Hsf DmHSF HSF Hsf dHSF hsf l(2)03091

CG5748-RA (691)
(HSF_DNA-bin)
(0003351)

MSRSRSSAKAVQFKHESEEEEEDEEEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRL ICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFS HPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSKILTDVKVMRGRQDNLDSRFSAMKQENE VLWREIASLRQKHAKQQQIVNKLIQFLITIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETES ESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVSPPAVERPRSNMSISSHNVDYSNQSVE DLLLQGNGTAGGNILVGGAASPMAQSVSQSPAQHDVYTVTEAPDSHVQEVPNSPPYYEEQNVLTT PMVREQEQQKRQQLKENNKLRRQAGDVILDAGDILVDSSSPKAQRTSIQHSTQPDVMVQPMIIKS EPENSSGLMDLMTPANDLYSVNFISEDMPTDIFEDALLPDGVEEAAKLDQQQKFGQSTVSSGKFA SNFDVPTNSTLLDANQASTSKAAAKAQASEEEGMAVAKYSGAENGNNRDTNNSQLLRMASVDELH GHLESMQDELETLKDLLRGDGVAIDQNMLMGLFNDSDLMDNYGLSFPNDSISSEKKAPSGSELIS YQPMYDLSDILDTDDGNNDQEASRRQMQTQSSVLNTPRHEL


YES DNA binding (if we think it is a transcription factor)
YES site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
We have previously reported evidence that subunits of HSF associate to form homotrimers and that each subunit contacts a conserved 5 bp DNA sequence repeated within an HSE. Here we show that HSF binding is highly cooperative at two distinct levels: between subunits of the HSF multimer, and between multimers. P
 ** DNA binding G F P
 ** DNA binding G F
 ** DNA binding G F P
 ** transcription factor activity G F
 ** specific RNA polymerase II transcription factor activity G F P
 ** specific RNA polymerase II transcription factor activity G F
 nucleus G F P
 nucleus G F
 nucleus G F
 polytene chromosome G F P
 ** regulation of transcription from RNA polymerase II promoter G F
 defense response G F
 response to heat G F P
 response to heat G F
 response to heat G F P
 ** transcriptional activator activity G F
DBD yes / FlyReg TF / FlyMine TF
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database