FBgn0000256 --- capu (cappuccino)

CG15420 CG3399 Capu capp capu

CG3399-RC (1154)
(FH2)

MIVYPMEELYPAMMVIAITLLALLQWGIRATIKPKILGPQKNAIKNGVNNKRRKVLSAMQHDHIN MGNSQNRAANVDEKSPPGGASLVRMGITGGGGAGEVGVALSERRGSRVRVLSRLMGQKRIREAFL HSPKLGSSSEVNLQGAGNGSSDWIAAETEVEHGQLDCSAEPADFRVTGPAGPLGATTSSPSLETQ STVIISFKSSQTPVQSQTNSAASENVEDDTAPLPLPPPPPGFGTPTTPLLSSNVLKKVASFTVEK SSAGNNSSNPPNLCPTSDETTLLATPCSSSLTVATLPPEIAVGAAAGGVAGGAGSRRGSSYVPEK LSFAAYEKFEGQMLIKWLISTMQSNPKSSSGDANQELFNTLALQFCNNLKYVGVLKQISNEHLDC GFSPYEMYQWTHTEQPTTSLPLTPGKLDKVAAWPFSSTPSGIRALESASLASLGAGGVAGSLATI ATASTASSDNQKTLQQILKKRLLNCTTLAEVHAVVNELLSSVDEPPRRPSKRCVNLTELLNASEA TVYEYNKTGAEGCVKSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPP PPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPM SASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANST DSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETPLDNIDEFTELFSRQAIAPVSKPKEL KVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQR IKEAAGGDIPLDHPEQFLLDISLISMASERISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESE DLKLVFSIILTLGNYMNGGNRQRGQADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEG VHPLEIRLPIPEPADVERAAQMDFEEVQQQIFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKME EFVEGADKSMAKLHQSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIW KKEITSLLNELMKKSKQAQIESRRNVSTKVEKSGRISLKERMLMRRSKN


CG3399-RB (1049)
(FH2)

MREKERVQNTPPLTKQPRKRRIAPQPPPKPPPKPRKIRTEKTTNDDHCAFIEQLFFETTEAKPSA TVVAGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENVEDDTAPLPLPPPPP GFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPNLCPTSDETTLLATPCSSSLTVATLPPEI AVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFEGQMLIKWLISTMQSNPKSSSGDANQELFNT LALQFCNNLKYVGVLKQISNEHLDCGFSPYEMYQWTHTEQPTTSLPLTPGKLDKVAAWPFSSTPS GIRALESASLASLGAGGVAGSLATIATASTASSDNQKTLQQILKKRLLNCTTLAEVHAVVNELLS SVDEPPRRPSKRCVNLTELLNASEATVYEYNKTGAEGCVKSFTDAETQTESEDCEGTCKCGQSST KVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGS GSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPM RPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETP LDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEHAIYHI DTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASERISCIVFQAEF EESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQADGFNLDILGKLKDV KSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDFEEVQQQIFDLNKKFLG CKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQSLDECRDLFLETMRFYHFSPKACTL TLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKKSKQAQIESRRNVSTKVEKSGRISLKE RMLMRRSKN


CG3399-RD (1207)
(FH2)

MGNSQNRAANVDEKSPPGGASLVRMGITGGGGAGEVGVALSERRGSRVRVLSRLMGQKRIREAFL HSPKLGSSSEVNLQGAGNGSSDWIAAETEVEHGQLDCSAEPADFPPAKPPRLRRQLQTPVESEDH CSLSLGQLCQLQLQYDNKRHEEESQRILMREKERVQNTPPLTKQPRKRRIAPQPPPKPPPKPRKI RTEKTTNDDHCAFIEQLFFETTEAKPSATVVAGVTGPAGPLGATTSSPSLETQSTVIISFKSSQT PVQSQTNSAASENVEDDTAPLPLPPPPPGFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPN LCPTSDETTLLATPCSSSLTVATLPPEIAVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFEGQ MLIKWLISTMQSNPKSSSGDANQELFNTLALQFCNNLKYVGVLKQISNEHLDCGFSPYEMYQWTH TEQPTTSLPLTPGKLDKVAAWPFSSTPSGIRALESASLASLGAGGVAGSLATIATASTASSDNQK TLQQILKKRLLNCTTLAEVHAVVNELLSSVDEPPRRPSKRCVNLTELLNASEATVYEYNKTGAEG CVKSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVAPPP PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPA PLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDE PPAANGADAPPTAPPATKEIWTEIEETPLDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLD PERSRNVGIIWRSLHVPSSEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLD HPEQFLLDISLISMASERISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTL GNYMNGGNRQRGQADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPE PADVERAAQMDFEEVQQQIFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAK LHQSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELM KKSKQAQIESRRNVSTKVEKSGRISLKERMLMRRSKN


CG3399-RA (1059)
(FH2)

MALQLGKKLAQVLGSGAGSPLTPGTMEPCAAGSGSPLANGELFNVSKAKKVELQNLSSRFTAAVT QTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENVEDDT APLPLPPPPPGFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPNLCPTSDETTLLATPCSSS LTVATLPPEIAVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFEGQMLIKWLISTMQSNPKSSS GDANQELFNTLALQFCNNLKYVGVLKQISNEHLDCGFSPYEMYQWTHTEQPTTSLPLTPGKLDKV AAWPFSSTPSGIRALESASLASLGAGGVAGSLATIATASTASSDNQKTLQQILKKRLLNCTTLAE VHAVVNELLSSVDEPPRRPSKRCVNLTELLNASEATVYEYNKTGAEGCVKSFTDAETQTESEDCE GTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAP PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMR KSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPPATK EIWTEIEETPLDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPS SEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASER ISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQADGFN LDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDFEEVQQQ IFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQSLDECRDLFLETMRF YHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKKSKQAQIESRRNVSTKV EKSGRISLKERMLMRRSKN


NO DNA binding (if we think it is a transcription factor)
site-specific transcription factor
putative short-range transcription factor
known or putative long-range transcription factor
 ** DNA binding G F
 actin binding G F
 structural constituent of cytoskeleton G F
 nucleus G F
 intracellular signaling cascade G F
 eggshell formation (sensu Insecta) G F P
 pole plasm assembly G F P
 pole plasm assembly G F P
 pole plasm assembly G F P
 pole plasm assembly G F P
 pole plasm assembly G F
 pole plasm RNA localization G F P
 oogenesis (sensu Insecta) G F
 cell organization and biogenesis G F
 pole plasm oskar mRNA localization G F P
 pole plasm assembly (sensu Insecta) G F P
DBD no
Comment
Database entries
Meaningful phrase
Curator's verdict
Protein information
GO annotation (legend)
www.FlyTF.org - The Drosophila Transcription Factor Database